Solanum stenotomum: 39717198 Help Entry 39717198          CDS       T08385                                  Symbol atpH, E6S78_pgp078 Name (RefSeq) AtpH   KO K02110   F-type H+-transporting ATPase subunit c Organism sstn  Solanum stenotomum Pathway sstn00190   Oxidative phosphorylation sstn00195   Photosynthesis sstn01100   Metabolic pathways Module sstn_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sstn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     39717198 (atpH)    00195 Photosynthesis     39717198 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sstn00194]     39717198 (atpH) Photosynthesis proteins [BR:sstn00194]  Photosystem and electron transport system   F-type ATPase [OT]    39717198 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  39717198 NCBI-ProteinID:  YP_009586654 UniProt:  A0A482C4M2 LinkDB All DBs Position Pltd:complement(13548..13793) Genome browser AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttccgccgcttccgttattgctgctggattggccgtagggcttgct tctattggacctggaattggtcaagggactgctgcgggtcaagctgtagagggtatcgcg agacagcctgaggcagagggaaaaatacgaggtacgctattgcttagtctagcttttatg gaagctttaacaatttatggactggttgtagcattagcacttttatttgcaaatcctttt gtttaa

DBGET integrated database retrieval system