Sphingomonas suaedae: FPZ54_00070 Help Entry FPZ54_00070       CDS       T07976                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ssua  Sphingomonas suaedae Brite KEGG Orthology (KO) [BR:ssua00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ssua03110]     FPZ54_00070 (grxC) Chaperones and folding catalysts [BR:ssua03110]  Protein folding catalysts   Protein disulfide isomerase    FPZ54_00070 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 SH3BGR Glrx-like GST_N Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  QDX24580 UniProt:  A0A518RAV4 LinkDB All DBs Position 11733..11990 Genome browser AA seq 85 aa AA seqDB search MAKIEIYTKAFCGYCARAKALLDSKGADYEEFDLTMGGPKRQEMIQRANGRTTVPQIFID GAHIGGSDDLMALERDGRLDPLLGR NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcgaaaatcgaaatctataccaaggcattttgcggctattgcgcgcgggccaaggcg ctgctcgacagcaagggcgccgattacgaggaattcgacctgacgatgggcgggccgaag cggcaggagatgatccagcgcgcaaacggcaggaccactgtgccgcagattttcatcgac ggcgcgcatatcggcgggtcggacgatctgatggcgctggagcgcgacggcaggctggat ccgctgctcggccgatga

DBGET integrated database retrieval system