Sphingomonas suaedae: FPZ54_07330 Help Entry FPZ54_07330       CDS       T07976                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssua  Sphingomonas suaedae Pathway ssua01100   Metabolic pathways ssua01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssua00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPZ54_07330    00074 Mycolic acid biosynthesis     FPZ54_07330   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPZ54_07330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 RE_Bsp6I Motif Other DBs NCBI-ProteinID:  QDX25852 UniProt:  A0A518REH0 LinkDB All DBs Position 1535893..1536135 Genome browser AA seq 80 aa AA seqDB search MSDRNDIFATVTGLIEPFNKKGIALTDSTTFAGDLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIETVGQLVDAVQKLKA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgatcgtaacgacatctttgccaccgtcaccggcctgatcgaacccttcaacaag aagggcatcgcactgaccgattccaccacctttgccggcgatctcgaatgggacagcctg accgtgatggatttcgtcgcggcgatcgaggacgagttcgacatcattatcacgatgaac atgcaggccgagatcgaaaccgtcggccagctggtcgatgcggtccagaagctgaaggcc tga

DBGET integrated database retrieval system