Streptomyces subrutilus: CP968_05710 Help Entry CP968_05710       CDS       T07087                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism ssub  Streptomyces subrutilus Pathway ssub01051   Biosynthesis of ansamycins ssub01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:ssub00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     CP968_05710    01051 Biosynthesis of ansamycins     CP968_05710  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssub01008]     CP968_05710 Polyketide biosynthesis proteins [BR:ssub01008]  Polyketide tailoring proteins   Others    CP968_05710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEU77840 UniProt:  A0A5P2UFU9 LinkDB All DBs Position complement(1316345..1316620) Genome browser AA seq 91 aa AA seqDB search MSTPTTPADTTEAIRATLSAFLEQRTRTAVGPDVDLFATGLVTSLFAMELLVHVEQSFGV QVGGQDLTLDNFRSVDRMTALVLRLRGGTGE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagcaccccgacgaccccggcggacaccaccgaggcgatccgcgcgaccctctccgcc ttcctggagcagcgcacccgcacggccgtcgggcccgacgtggacctgttcgccaccggc ctggtgacctccctgttcgccatggagctgctggtccacgtcgagcagtccttcggcgtc caggtcggcggccaggacctcacgctggacaacttccgcagcgtggaccggatgaccgcg ctcgtcctgcggctgcggggtggtaccggtgagtga

DBGET integrated database retrieval system