KEGG   Streptomyces subrutilus: CP968_05830
Entry
CP968_05830       CDS       T07087                                 

Name
(GenBank) inosamine-phosphate amidinotransferase 1
  KO
K04340  scyllo-inosamine-4-phosphate amidinotransferase 1 [EC:2.1.4.2]
Organism
ssub  Streptomyces subrutilus
Pathway
ssub00521  Streptomycin biosynthesis
ssub01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssub00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CP968_05830
Enzymes [BR:ssub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.2  scyllo-inosamine-4-phosphate amidinotransferase
     CP968_05830
SSDB
Motif
Pfam: ADI
Other DBs
NCBI-ProteinID: QEU77861
UniProt: A0A5P2UJJ6
LinkDB
Position
1346922..1347968
AA seq 348 aa
MSLVSVHNEWDPLEEIIVGTAVGARVPRPDRSVFTVEYADQYDDQEQVPSGPYPDRVLKE
TEEELQILAEELGRLGVTVRRPGERDQSATLATPDWQTDGFHDYCPRDGLLSVGQTVIET
PMALRARFLESLAYKDILLEYFASGTRWISAPKPRLTDGMYDPSAPAGERLLEQEPVFDA
ANVLRFGTDLLYLVSDSGNELGAKWLQSAVGDAYTVHPCRKLYASTHVDSTIVPLRPGLV
LVNPSRVNDGNMPEFLRSWQTITCPDLVDIGFTGDRPHCSVWIGMNLLVVRPDLAVVDRR
QTGLIKLLEKHGMDVLPLQLTHSRTLGGGFHCATLDVRRTGSLETYRF
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgagtctcgtcagcgtgcacaacgaatgggatccgctggaggagataatcgtcggtacg
gccgtcggggcgcgcgttccccggcccgatcgcagtgtgttcacggtcgagtacgccgac
cagtacgacgaccaggagcaggtcccctccggcccctatccggaccgggtgctgaaggag
accgaggaggagctccagatcctggccgaggagctgggccggctgggggtcacggtccgg
cgtcccggcgagcgggaccagtccgcgaccctcgccacccccgactggcagaccgacggc
ttccacgactactgcccgcgcgacggcctcctctcggtcgggcagacggtcatcgagacc
ccgatggccctgcgcgcccggttcctggagtcgctggcgtacaaggacatcctgctggag
tacttcgcctccggcacccgctggatctccgcgcccaagccgcggctcaccgacggcatg
tacgatccgtcggcgcccgcgggagagcggctcctggagcaggagccggtcttcgacgcg
gcgaacgtgctccgcttcggcaccgacctgctgtacctggtctccgacagcggcaacgaa
ctcggcgccaagtggctccagtcggcggtcggcgacgcctacaccgtgcacccgtgccgc
aagctgtacgcctccacccacgtcgactccaccatcgtgccgctgcggcccggcctggtg
ctcgtcaacccgtcgcgggtcaacgacggcaacatgccggagttcctgcggtcctggcag
accatcacctgcccggacctggtggacatcggcttcaccggcgaccgcccgcactgctcg
gtgtggatcgggatgaacctgctggtcgtacggcccgacctcgcggtggtggaccgccgc
cagaccgggctgatcaagctgctggagaagcacggcatggacgtgctgccgctgcagctc
acccattcccggaccctcgggggcggtttccactgcgccaccctcgacgtccggcgcacc
gggtcgctggagacctaccggttctga

DBGET integrated database retrieval system