Streptomyces subrutilus: CP968_22875 Help Entry CP968_22875       CDS       T07087                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssub  Streptomyces subrutilus Pathway ssub00998   Biosynthesis of various antibiotics ssub01100   Metabolic pathways ssub01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssub00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP968_22875    00074 Mycolic acid biosynthesis     CP968_22875   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP968_22875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEU80745 UniProt:  A0A5P2UR06 LinkDB All DBs Position complement(5159408..5159656) Genome browser AA seq 82 aa AA seqDB search MAATQEEILEGLAEIVNEIAGIPQEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFEVKIP DEDVKNLKTVGDAADYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcctcgaaggtctcgcggagatcgtcaacgagatcgcc ggcatcccgcaggaggacgtccagctcgacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgaggtcaagatcccg gacgaggacgtcaagaacctcaagacggtcggcgacgcggccgactacatcctgaagcac caggcctga

DBGET integrated database retrieval system