Streptococcus suis T15: T15_0025 Help Entry T15_0025          CDS       T02891                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssui  Streptococcus suis T15 Pathway ssui01100   Metabolic pathways ssui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     T15_0025 (acpP)    00074 Mycolic acid biosynthesis     T15_0025 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     T15_0025 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5578 DUF1493 Motif Other DBs NCBI-ProteinID:  AGZ22146 LinkDB All DBs Position 30349..30597 Genome browser AA seq 82 aa AA seqDB search MTREQVYQRVVELIQDEKGEDFQVQPESTLADNIAADSVEIMEFVLNLEDEFHVDVPDAA IEHFEVLSDIVDFIYEEVKKRS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactagagagcaggtctatcagcgggttgttgaattaattcaggatgaaaagggagaa gattttcaagttcaacctgaatctactttggcagataacattgcagcagattcagtagaa atcatggaatttgttcttaatttggaggatgaatttcatgtagatgtcccagatgctgct attgagcattttgaggtcctatctgatattgttgattttatttatgaagaagtaaaaaaa cgttcgtag

DBGET integrated database retrieval system