Shinella sumterensis: Q9314_04440 Help Entry Q9314_04440       CDS       T09417                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssum  Shinella sumterensis Pathway ssum01100   Metabolic pathways ssum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q9314_04440    00074 Mycolic acid biosynthesis     Q9314_04440   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q9314_04440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  WLS09028 LinkDB All DBs Position complement(850021..850257) Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgtcattgatcatctgggcgttgacgcc gaaaaggtcagcgaaggcgcaagcttcatcgatgaccttggcgcggactccctcgacacc gttgagctggtcatggcgttcgaagaagaattcggcgtcgagatcccggacgatgccgcg gactcgatcctgacggtcggcgacgctgtcaagttcatcgagaaggcccaggcctga

DBGET integrated database retrieval system