KEGG   Shinella sumterensis: Q9314_07380
Entry
Q9314_07380       CDS       T09417                                 
Name
(GenBank) ABC transporter permease subunit
  KO
K12370  dipeptide transport system permease protein
Organism
ssum  Shinella sumterensis
Pathway
ssum02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ssum00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Q9314_07380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssum02000]
    Q9314_07380
Transporters [BR:ssum02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    Q9314_07380
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: WLS09580
LinkDB
Position
complement(1440190..1441098)
AA seq 302 aa
MSIVQNTAETKTGGTPPSGLSEFWYYFSRNKGAVIGLFVFLFILFMAIFAPFVAPHSPSI
QNRELLLLPPVFQQGGSWGHILGTDAVGRDILSRIIYGARFSLFIGLVVVTLSVVSGVLI
GLVAGYFRGKVDTFIMRIMDIILAFPSLLLALVLVAVLGPGLLNAMIAISLVNQPHFVRL
TRAAVMTEKSKDYVVGSKVAGAGTLRLMFLTILPNCLAPLIVQATLAFSAAILDAAALGF
LGMGAQPPTPEWGTMLAEAREFIQRAWWVVTFPGLAILITVLAINLMGDGLRDALDPKLK
RS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagcatcgttcagaacacggccgaaaccaagacgggtggcacgccgccctccggcctt
tccgaattctggtattacttctcgcgcaacaagggcgccgtcatcggcctctttgttttc
ctcttcattctgttcatggcgatcttcgcgcccttcgttgctccgcacagtccgagcatc
cagaaccgtgaacttctcctcttgccgcctgtcttccagcagggtgggtcctggggacac
atcctgggcacggacgctgtcggtcgcgatatcctttcgcgcatcatctacggcgcgcgc
ttctcgctgttcatcggtctcgtcgtcgtgacgctgtcggtggtgtcgggcgttctgatc
ggtctcgtcgcgggctatttccgcggcaaggtcgatacgttcatcatgcgcatcatggac
atcatcctggcgtttccctcgctgctgctggcgctcgtgctcgtggcggttctggggccg
ggcctgctgaacgcgatgatcgccatctcgctcgtcaaccagccgcatttcgtgcgcctg
acgcgcgcggcggtcatgaccgaaaagtcgaaggactatgtcgtcggctcgaaggtcgcg
ggtgcgggcacgctgcggctgatgttcctgaccatcttgccgaactgcctggcgccgctc
atcgtgcaggcgacgctcgccttctcggcggcgatcctcgatgcggccgccctcggcttc
ctcggcatgggcgcccagccgccgacgccggaatggggcacgatgctcgccgaggcacgt
gaattcatccagcgcgcctggtgggtcgtcacgttcccgggccttgccatcctgatcacc
gtgcttgccatcaacctcatgggtgacggcctgcgcgacgccctcgatcccaagctgaag
aggtcgtga

DBGET integrated database retrieval system