KEGG   Shinella sumterensis: Q9314_10660
Entry
Q9314_10660       CDS       T09417                                 
Name
(GenBank) YggS family pyridoxal phosphate-dependent enzyme
  KO
K06997  PLP dependent protein
Organism
ssum  Shinella sumterensis
Brite
KEGG Orthology (KO) [BR:ssum00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    Q9314_10660
SSDB
Motif
Pfam: Ala_racemase_N
Other DBs
NCBI-ProteinID: WLS06682
LinkDB
Position
2111348..2112007
AA seq 219 aa
MELEDRLEEVRSRVRKAASEAGRKPEQVTLVAVSKTFDADAIRPAIAAGQRVFGENRVQE
AQGKWPELRAQTAGIELHLIGPLQSNKTADAVALFDVIETVDREKIARSIADEMKRQGRA
LRLYVQVNTGLEPQKAGIAPDDTLSFVTFCREELGLTIEGLMCIPPADENPGPHFALLAK
LAARCSLDRLSMGMSGDYEVAIGFGATSVRVGSAIFGTR
NT seq 660 nt   +upstreamnt  +downstreamnt
atggaacttgaggaccgtctcgaagaggtgcgcagccgcgtgcgcaaggccgcaagcgag
gcgggccgcaagccggagcaggtcacgctggtcgcggtatcaaagaccttcgatgccgat
gcgatccggcccgccatcgcagccgggcagcgcgtcttcggcgaaaaccgtgtgcaggag
gcgcagggcaagtggccggaattgcgcgcgcagacggccggcatcgagttgcacctgatc
ggccccctgcaatcgaacaagacggcggatgccgttgccctgttcgacgtgatcgagacg
gtcgaccgggaaaagatcgcgcgcagcatcgccgacgagatgaagcggcagggacgggcg
ctgcggctttacgtgcaggtcaatacggggctcgagccccagaaagccggcattgcgcct
gatgataccctctccttcgtgaccttctgccgcgaggagctgggcctgaccatcgagggc
ctgatgtgcattccgccggcggatgaaaatcccgggccgcattttgccctgctggccaag
cttgccgcccgctgcagcctcgaccggttgtcgatgggcatgtcgggcgactacgaggtt
gccatcggtttcggcgcgaccagcgtgcgcgtcggttcggcgatcttcggcacgcgctga

DBGET integrated database retrieval system