Shinella sumterensis: Q9314_10660
Help
Entry
Q9314_10660 CDS
T09417
Name
(GenBank) YggS family pyridoxal phosphate-dependent enzyme
KO
K06997
PLP dependent protein
Organism
ssum
Shinella sumterensis
Brite
KEGG Orthology (KO) [BR:
ssum00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99985 Amino acid metabolism
Q9314_10660
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID:
WLS06682
LinkDB
All DBs
Position
2111348..2112007
Genome browser
AA seq
219 aa
AA seq
DB search
MELEDRLEEVRSRVRKAASEAGRKPEQVTLVAVSKTFDADAIRPAIAAGQRVFGENRVQE
AQGKWPELRAQTAGIELHLIGPLQSNKTADAVALFDVIETVDREKIARSIADEMKRQGRA
LRLYVQVNTGLEPQKAGIAPDDTLSFVTFCREELGLTIEGLMCIPPADENPGPHFALLAK
LAARCSLDRLSMGMSGDYEVAIGFGATSVRVGSAIFGTR
NT seq
660 nt
NT seq
+upstream
nt +downstream
nt
atggaacttgaggaccgtctcgaagaggtgcgcagccgcgtgcgcaaggccgcaagcgag
gcgggccgcaagccggagcaggtcacgctggtcgcggtatcaaagaccttcgatgccgat
gcgatccggcccgccatcgcagccgggcagcgcgtcttcggcgaaaaccgtgtgcaggag
gcgcagggcaagtggccggaattgcgcgcgcagacggccggcatcgagttgcacctgatc
ggccccctgcaatcgaacaagacggcggatgccgttgccctgttcgacgtgatcgagacg
gtcgaccgggaaaagatcgcgcgcagcatcgccgacgagatgaagcggcagggacgggcg
ctgcggctttacgtgcaggtcaatacggggctcgagccccagaaagccggcattgcgcct
gatgataccctctccttcgtgaccttctgccgcgaggagctgggcctgaccatcgagggc
ctgatgtgcattccgccggcggatgaaaatcccgggccgcattttgccctgctggccaag
cttgccgcccgctgcagcctcgaccggttgtcgatgggcatgtcgggcgactacgaggtt
gccatcggtttcggcgcgaccagcgtgcgcgtcggttcggcgatcttcggcacgcgctga
DBGET
integrated database retrieval system