KEGG   Serratia surfactantfaciens: ATE40_002215
Entry
ATE40_002215      CDS       T06779                                 
Name
(GenBank) acetylornithine aminotransferase
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
ssur  Serratia surfactantfaciens
Pathway
ssur00333  Prodigiosin biosynthesis
ssur01100  Metabolic pathways
ssur01110  Biosynthesis of secondary metabolites
Module
ssur_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:ssur00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ATE40_002215
Enzymes [BR:ssur01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     ATE40_002215
SSDB
Motif
Pfam: Aminotran_3 DUF5587
Other DBs
NCBI-ProteinID: AOE98140
LinkDB
Position
complement(474830..477391)
AA seq 853 aa
MKFGFIAHPTSLGLKRYVKMLDLLQRNSTEQHSGYTRELWERQNLVPFMNFARITSATGA
TCEGVIKYMPLVADEMLADARGIAARVVQGIEELAGDGAELVGLGGFTSIVGRRGEATAE
KSPVPVTSGNSLTTYAGYKALMQIQSWLEIRPEEEPVAIVGYPGSICLALSRLLLAHGFS
LHLLHRAGNHDRSELLSHLPEEYHSRVTLTSDPEDLYPRCKLFAAATSAGGVIDPARLQP
GSIFIDVALPRDIASETRPARDDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAET
IVLALENRRENFSLGRYLAPEKVLEIGEIAERHGFFAYPLASYGERIDRQSVTNLKRYYH
HDIYAGESADAALPASRLAFIDAVIAQTPAREDTLDRYHQYINPMMVDFLKLQRCDNVFR
RAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPNFIQYISIPEQTA
KLAEVLCRLAPGNMGRVFFSNSGTEAVEAAMKIAKASTGKPGIAYLRNSYHGKTLGALSI
TGRDKHRRYFTPLLDAMVEVPFGDLAALREALNREDVGALMIEPIQGEGGVHIPPAGYLQ
AVQQLCRETGVLLMVDEVQTGLGRTGKLFACEWDGIEPDVLMLSKSLSGGLIPIGATLCR
ADLWQKAYGTADRFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSE
IAARYPFVSEVRGRGLMLGIQFDQAFTGAVNASAREFATRLPGDWHTTWKFLPDPVQAHL
RAAMDRMEQALGEMFCMKFVTKLCQDHKILTFITANSSTVIRIQPPLIISKAEIDRFVGA
FATVCEELSTFLD
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaaattcggattcatcgctcatcccacctcgctggggttgaaacgttacgtcaaaatg
ctcgatctgctgcaacgcaactcgaccgagcagcacagcggctatacgcgtgaactgtgg
gaacgacaaaacctggttccctttatgaacttcgccaggatcacctcggcgaccggcgcc
acttgcgaaggggtgatcaaatacatgccgctggtggcggatgaaatgctggccgacgca
cgcggtatcgccgccagggtggtccaaggcatcgaagagctggccggcgatggcgccgaa
ctggtcggtctcggcggttttacctctatcgttgggcgacgcggcgaagccactgcggaa
aagtcgccggtaccggtcacctccggcaactctctgaccacctacgccggctacaaggcc
ttgatgcagatccagtcctggctggaaatccgcccggaggaggaacccgtcgccatcgtc
ggctatccgggatcgatctgcctggcgctaagccgtctgctgctggcgcacggtttctct
ctccatttgctgcaccgcgccggcaaccatgatcgcagcgaactgctcagccatttgccc
gaggagtatcactcgcgcgtcaccctgaccagcgatcccgaagatctctacccgcgctgc
aaactgtttgccgccgcgacctccgccggcggcgtgatcgaccccgccagactgcaaccc
ggctcgatcttcatcgacgtggcgctgccgcgggatatcgcttcggaaacgcgcccggcg
cgggatgacattctgatcatcgacggcggctgcgtcaccgccaccgatgcggtcaagttg
ggtggagaatcgctcaacgtcaccatcaagcaacaattgaacggctgcatggcggaaacc
attgtgctggcgctggaaaaccggcgggaaaacttttcgctgggccgctatctggcgccg
gaaaaagtgctggagatcggtgaaatcgccgagcgccacgggttcttcgcctatccgctg
gcctcgtacggcgagcgcatcgatcggcagagcgtgaccaatctcaagcgctactaccac
catgacatctatgccggggaatcggctgatgcggcgctgcccgcatcgcgcctggcgttt
atcgacgcggtcatcgcccaaacgcccgccagggaagacaccctcgaccgctatcatcaa
tacatcaaccccatgatggtggacttccttaagttgcagcgctgcgacaacgttttccgc
cgcgccgccggcacccagttgtatgacgatgcgggcgaggctttcctggacatggtggcg
ggctacgggtgcctaaacctgggccacaacccgcagccagtggtcaacgcgctgaaaaac
tacctcgacgctcaaggtcccaacttcattcaatacatttccattcccgaacagaccgcc
aagttggccgaagtgctctgtcgtctggcgccgggcaatatgggccgggtgttcttcagc
aactccggcaccgaagccgtcgaagccgcgatgaagatcgccaaggcctcgacgggcaag
ccgggcatcgcctatctgcgcaacagttaccacggtaaaacgctgggcgcgttgtccatc
accggacgagacaaacaccgccgctatttcacaccgctgctggacgcaatggtggaagtg
ccgttcggcgatctcgccgcgctgcgggaagcgctgaaccgtgaagacgtcggcgcgctg
atgatcgaaccgatccagggcgaaggcggcgtgcatatcccgcccgccggttacctgcag
gcggtgcagcagctctgccgcgagaccggtgtgctgctgatggtggacgaagtgcaaacc
gggcttgggcgcaccggcaaacttttcgcctgcgaatgggacggtatcgagccggacgtg
ctgatgctgtcgaaatccctgtccggcggcctgatccccatcggcgccacgctgtgccga
gccgatctttggcaaaaagcctatggcacggcggatcgcttcctggtgcacagctccacc
tacggcggcggcaacctcgcctcagttgtcgccctcagcgcgctgcgcgagatcctggcg
caggatttggtcggccatgccgaacggatgggcgcctactttaagcaggcactgagcgag
atcgccgcccgctatccgttcgtcagcgaggtgcgcggccgcggcctgatgctggggatc
cagttcgaccaggcgttcaccggcgcggtcaacgcctccgcccgcgaattcgccacccgg
ctgccgggcgattggcacaccacctggaaattcttgcccgatccggtgcaagcccatctg
cgggcggcgatggatcgcatggaacaggcgctcggcgaaatgttctgcatgaaattcgtc
accaagctgtgccaggaccacaagatcctgaccttcattaccgccaacagctcgacggtg
atccgtattcaacccccgctcatcatcagcaaagccgagatcgaccgtttcgtcggcgcc
tttgccacggtgtgcgaggaactctccacctttttagactag

DBGET integrated database retrieval system