Serratia surfactantfaciens: ATE40_006045 Help Entry ATE40_006045      CDS       T06779                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ssur  Serratia surfactantfaciens Brite KEGG Orthology (KO) [BR:ssur00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ssur03400]     ATE40_006045 DNA repair and recombination proteins [BR:ssur03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     ATE40_006045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF5388 Motif Other DBs NCBI-ProteinID:  AOE98844 LinkDB All DBs Position complement(1278652..1278891) Genome browser AA seq 79 aa AA seqDB search MRVEVTIDKTRPLPSGAIEALTGELGKRVNRQFPDAVVHVRYAGTNGLSVLGGAKTDRDL IEEILQETWESADEWFSAE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaagtcactatagataaaacccggccgctgccgtcgggcgcgattgaggcg ctgaccggtgaactgggcaagcgggtcaatcgccagtttccagacgccgtcgtgcacgtc cgctatgccggcaccaacgggctctccgtgctggggggtgccaaaaccgaccgggatctg atcgaggaaatccttcaggaaacctgggaaagcgcggacgaatggttcagcgcagaataa

DBGET integrated database retrieval system