Serratia surfactantfaciens: ATE40_006100 Help Entry ATE40_006100      CDS       T06779                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssur  Serratia surfactantfaciens Pathway ssur01100   Metabolic pathways ssur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ATE40_006100    00074 Mycolic acid biosynthesis     ATE40_006100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ATE40_006100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  AOF02194 LinkDB All DBs Position 1290729..1290965 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVLNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgagcaactgggtgttaaacag gaagaagttttgaacaacgcttctttcgttgaagatctgggcgctgattctcttgacacc gttgagctggtaatggcactggaagaagaattcgacaccgagattccagacgaagaagct gagaagatcactactgttcaggcagctattgatttcatcaacgctagccagcagtaa

DBGET integrated database retrieval system