Serratia surfactantfaciens: ATE40_012905 Help Entry ATE40_012905      CDS       T06779                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssur  Serratia surfactantfaciens Pathway ssur01100   Metabolic pathways ssur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ATE40_012905    00074 Mycolic acid biosynthesis     ATE40_012905   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ATE40_012905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOF00107 LinkDB All DBs Position 2739217..2739477 Genome browser AA seq 86 aa AA seqDB search MLNRDAVMDYILTCLQGIVEGGVEIKPDSDLVNDLGLESIRVLDLLMMLEDELDISIPIN ILLDVRTPEQLLDALRPYLEKSHGTV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctaaatcgcgatgctgtaatggattatatcctgacgtgtttgcaaggtatcgtcgaa ggcggagtcgaaataaagcctgatagcgatctcgtcaatgatcttggcctggaatccatc agggtattggatctgctgatgatgctggaagatgaattagatatctccatcccgatcaat atattgcttgatgtcagaacgccagagcaactgcttgacgcgctgcgcccttatctggag aaaagccatgggactgtatga

DBGET integrated database retrieval system