Streptococcus suis TL13 (serotype 16): TL13_0044 Help Entry TL13_0044         CDS       T02672                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ssut  Streptococcus suis TL13 (serotype 16) Pathway ssut01100   Metabolic pathways ssut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TL13_0044 (acpP)    00074 Mycolic acid biosynthesis     TL13_0044 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TL13_0044 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5578 DUF1493 Motif Other DBs NCBI-ProteinID:  AGL47011 LinkDB All DBs Position 30242..30490 Genome browser AA seq 82 aa AA seqDB search MTREQVYQRVVELIQDEKGEDFQVQPESTLADNIAADSVEIMEFVLNLEDEFHVDVPDAA IEHFEVLSDIVDFIYEEVKKRS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactagagagcaggtctatcagcgggttgttgaattaattcaggatgaaaagggagaa gattttcaagttcaacctgaatctactttggcagataatattgcagcagattcagtagaa atcatggaatttgttcttaatttggaggatgaatttcatgtagatgtcccagatgctgct attgagcattttgaggtcctatctgatattgttgattttatttatgaagaagtaaaaaaa cgttcgtag

DBGET integrated database retrieval system