Streptococcus suis 98HAH33 (serotype 2): SSU98_0028 Help Entry SSU98_0028        CDS       T00515                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ssv  Streptococcus suis 98HAH33 (serotype 2) Pathway ssv01100   Metabolic pathways ssv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SSU98_0028    00074 Mycolic acid biosynthesis     SSU98_0028   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SSU98_0028 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5578 DUF1493 Motif Other DBs NCBI-ProteinID:  ABP91188 LinkDB All DBs Position 30349..30597 Genome browser AA seq 82 aa AA seqDB search MTREQVYQRVVELIQDEKGEDFQVQPESTLADNIAADSVEIMEFVLNLEDEFHVDVPDAA IEHFEVLSDIVDFIYKEVKKRS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactagagagcaggtctatcagcgggttgttgaattaattcaggatgaaaagggagaa gattttcaagttcaacctgaatctactttggcagataatattgcagcagattcagtagaa atcatggaatttgttcttaatttggaggatgaatttcatgtagatgtcccagatgctgct attgagcattttgaggttctatctgatattgttgattttatttataaagaagtaaaaaaa cgttcgtag

DBGET integrated database retrieval system