Sphingobium sp. SYK-6: SLG_01070 Help Entry SLG_01070         CDS       T01622                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssy  Sphingobium sp. SYK-6 Pathway ssy01100   Metabolic pathways ssy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SLG_01070    00074 Mycolic acid biosynthesis     SLG_01070   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SLG_01070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BAK64782 UniProt:  G2IJB2 LinkDB All DBs Position 104509..104757 Genome browser AA seq 82 aa AA seqDB search MSDRQDIFGQVAAQIEPFNKKGVALNETTSFAGDLEWDSLTVMDFVAAVEDEFDIIITMN MQAEIETVGQLVDAVLKLRAEG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcggatcgccaggacattttcgggcaggtcgccgcgcagatcgaacctttcaacaag aagggcgtggccctgaacgagaccaccagctttgccggagacctcgagtgggacagtctc acggtcatggatttcgtggcggccgtcgaagatgaattcgacatcatcatcacgatgaac atgcaggcggagatcgagaccgttgggcagcttgtggatgctgtcctgaagctccgggcg gagggctga

DBGET integrated database retrieval system