Saccharothrix syringae: EKG83_16110 Help Entry EKG83_16110       CDS       T06258                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssyi  Saccharothrix syringae Pathway ssyi00998   Biosynthesis of various antibiotics ssyi01100   Metabolic pathways ssyi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssyi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EKG83_16110    00074 Mycolic acid biosynthesis     EKG83_16110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EKG83_16110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QFZ18773 UniProt:  A0A5Q0GXY6 LinkDB All DBs Position complement(3636763..3637029) Genome browser AA seq 88 aa AA seqDB search MDRNTVVSALEQALTEVLERPVTGLDGHVRLFDDLHLDSTTMLEMLMALEDSLGLVVDPE DLDADDFVSVDTFTTFVLSSLSTARAAS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaccgcaacaccgtcgtctccgcgctggagcaggccctgaccgaggtgctggagcgg cccgtcaccgggctcgacggccacgtcaggctcttcgacgacctgcacctggactccacc acgatgctggagatgctgatggccctggaggactccctcggcctggtcgtcgacccggag gacctcgacgccgacgacttcgtctcggtggacaccttcaccacgttcgtcctctcctcg ctgagcacggcgcgggccgcgtcgtga

DBGET integrated database retrieval system