Saccharothrix syringae: EKG83_16310 Help Entry EKG83_16310       CDS       T06258                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism ssyi  Saccharothrix syringae Pathway ssyi00253   Tetracycline biosynthesis ssyi01056   Biosynthesis of type II polyketide backbone ssyi01100   Metabolic pathways ssyi01110   Biosynthesis of secondary metabolites Module ssyi_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:ssyi00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     EKG83_16310    00253 Tetracycline biosynthesis     EKG83_16310  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:ssyi01004]     EKG83_16310    01008 Polyketide biosynthesis proteins [BR:ssyi01008]     EKG83_16310 Lipid biosynthesis proteins [BR:ssyi01004]  Polyketide synthase   Component type    EKG83_16310 Polyketide biosynthesis proteins [BR:ssyi01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      EKG83_16310     Nonaketide PKS      EKG83_16310     Decaketide PKS      EKG83_16310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QFZ18804 UniProt:  A0A5Q0GZ47 LinkDB All DBs Position complement(3681468..3681725) Genome browser AA seq 85 aa AA seqDB search MSKMTVHDLHRILVQCAGEAEQGVLGADALDRDFDDLGYDSLALMETAAQIAKEYGVEIS DERVAELRTPREVLAVVNGDELERG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcaagatgaccgtccacgacctgcaccgcatcctcgtccagtgcgccggcgaggcc gagcagggcgtgctgggcgccgacgcgctggaccgggacttcgacgacctcggctacgac tcgctggcgctgatggagaccgccgcccagatcgccaaggagtacggcgtggagatctcc gacgagcgggtcgccgagctgcgcaccccgcgcgaggtgctggccgtggtcaacggcgac gagctggagcggggatga

DBGET integrated database retrieval system