Saccharothrix syringae: EKG83_32210 Help Entry EKG83_32210       CDS       T06258                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism ssyi  Saccharothrix syringae Pathway ssyi00253   Tetracycline biosynthesis ssyi01056   Biosynthesis of type II polyketide backbone ssyi01100   Metabolic pathways ssyi01110   Biosynthesis of secondary metabolites Module ssyi_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:ssyi00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     EKG83_32210    00253 Tetracycline biosynthesis     EKG83_32210  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:ssyi01004]     EKG83_32210    01008 Polyketide biosynthesis proteins [BR:ssyi01008]     EKG83_32210 Lipid biosynthesis proteins [BR:ssyi01004]  Polyketide synthase   Component type    EKG83_32210 Polyketide biosynthesis proteins [BR:ssyi01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      EKG83_32210     Nonaketide PKS      EKG83_32210     Decaketide PKS      EKG83_32210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QFZ21432 UniProt:  A0A5Q0H6U0 LinkDB All DBs Position complement(7690195..7690440) Genome browser AA seq 81 aa AA seqDB search MQDTKFTLDDLRRVLVEGAGADEGVDLAGDILDVEFDDLGYDSIALLETASRISRESGVP LDDTVASAKTPRELLALINGG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcaggacaccaagttcaccctcgacgacctgcggcgcgtgctcgtcgagggcgccggc gccgacgagggggtcgacctggccggcgacatcctcgacgtcgagttcgacgacctcggc tacgactcgatcgcgctgctggagaccgcgtcgcggatcagccgcgagagcggcgtcccg ctcgacgacaccgtcgcgtcggcgaagaccccgcgcgagctgctggcgctgatcaacggc gggtga

DBGET integrated database retrieval system