Symphalangus syndactylus (siamang): 129458609 Help Entry 129458609         CDS       T10134                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn03010   Ribosome ssyn04120   Ubiquitin mediated proteolysis ssyn04137   Mitophagy - animal ssyn04140   Autophagy - animal ssyn05012   Parkinson disease ssyn05022   Pathways of neurodegeneration - multiple diseases ssyn05167   Kaposi sarcoma-associated herpesvirus infection ssyn05171   Coronavirus disease Brite KEGG Orthology (KO) [BR:ssyn00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     129458609   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     129458609  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129458609    04137 Mitophagy - animal     129458609  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     129458609    05167 Kaposi sarcoma-associated herpesvirus infection     129458609   09164 Neurodegenerative disease    05012 Parkinson disease     129458609    05022 Pathways of neurodegeneration - multiple diseases     129458609  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ssyn03011]     129458609    04121 Ubiquitin system [BR:ssyn04121]     129458609 Ribosome [BR:ssyn03011]  Ribosomal proteins   Eukaryotes    Large subunit     129458609   Archaea     129458609 Ubiquitin system [BR:ssyn04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    129458609 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Ubiquitin_4 UBL_UBAC1 UBL_IKK Motif Other DBs NCBI-GeneID:  129458609 NCBI-ProteinID:  XP_055090581 LinkDB All DBs Position 12:complement(62947623..62947934) Genome browser AA seq 77 aa AA seqDB search MQIFVKTLTGKTITLEVEPNDTIENVKANIQDKEGILPDQQRLIFARMQLEDGCTLSDYN IQKESTLHLVQRLRRGC NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgtgaagaccctgactggcaagaccatcacccttgaggtggagcccaat gacaccatcgaaaatgtgaaggccaatatccaggataaggaaggcatcctccccgaccag cagaggctcatctttgcacgcatgcagctagaagatggctgcactctttctgactacaac atccagaaagagtcgaccctgcacctggttcagcgtctgagacgtggctgttaa

DBGET integrated database retrieval system