Symphalangus syndactylus (siamang): 129462037 Help Entry 129462037         CDS       T10134                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn01523   Antifolate resistance ssyn04010   MAPK signaling pathway ssyn04060   Cytokine-cytokine receptor interaction ssyn04064   NF-kappa B signaling pathway ssyn04217   Necroptosis ssyn04380   Osteoclast differentiation ssyn04620   Toll-like receptor signaling pathway ssyn04621   NOD-like receptor signaling pathway ssyn04623   Cytosolic DNA-sensing pathway ssyn04625   C-type lectin receptor signaling pathway ssyn04640   Hematopoietic cell lineage ssyn04657   IL-17 signaling pathway ssyn04659   Th17 cell differentiation ssyn04668   TNF signaling pathway ssyn04750   Inflammatory mediator regulation of TRP channels ssyn04932   Non-alcoholic fatty liver disease ssyn04933   AGE-RAGE signaling pathway in diabetic complications ssyn04936   Alcoholic liver disease ssyn04940   Type I diabetes mellitus ssyn05010   Alzheimer disease ssyn05020   Prion disease ssyn05022   Pathways of neurodegeneration - multiple diseases ssyn05132   Salmonella infection ssyn05133   Pertussis ssyn05134   Legionellosis ssyn05135   Yersinia infection ssyn05140   Leishmaniasis ssyn05142   Chagas disease ssyn05143   African trypanosomiasis ssyn05144   Malaria ssyn05146   Amoebiasis ssyn05152   Tuberculosis ssyn05162   Measles ssyn05163   Human cytomegalovirus infection ssyn05164   Influenza A ssyn05168   Herpes simplex virus 1 infection ssyn05171   Coronavirus disease - COVID-19 ssyn05321   Inflammatory bowel disease ssyn05323   Rheumatoid arthritis ssyn05332   Graft-versus-host disease ssyn05417   Lipid and atherosclerosis ssyn05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129462037 (IL1B)    04064 NF-kappa B signaling pathway     129462037 (IL1B)    04668 TNF signaling pathway     129462037 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129462037 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129462037 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     129462037 (IL1B)    04620 Toll-like receptor signaling pathway     129462037 (IL1B)    04621 NOD-like receptor signaling pathway     129462037 (IL1B)    04623 Cytosolic DNA-sensing pathway     129462037 (IL1B)    04625 C-type lectin receptor signaling pathway     129462037 (IL1B)    04659 Th17 cell differentiation     129462037 (IL1B)    04657 IL-17 signaling pathway     129462037 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     129462037 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     129462037 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     129462037 (IL1B)    05164 Influenza A     129462037 (IL1B)    05162 Measles     129462037 (IL1B)    05168 Herpes simplex virus 1 infection     129462037 (IL1B)    05163 Human cytomegalovirus infection     129462037 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     129462037 (IL1B)    05135 Yersinia infection     129462037 (IL1B)    05133 Pertussis     129462037 (IL1B)    05134 Legionellosis     129462037 (IL1B)    05152 Tuberculosis     129462037 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     129462037 (IL1B)    05144 Malaria     129462037 (IL1B)    05140 Leishmaniasis     129462037 (IL1B)    05142 Chagas disease     129462037 (IL1B)    05143 African trypanosomiasis     129462037 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     129462037 (IL1B)    05321 Inflammatory bowel disease     129462037 (IL1B)    05332 Graft-versus-host disease     129462037 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     129462037 (IL1B)    05020 Prion disease     129462037 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     129462037 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129462037 (IL1B)    05418 Fluid shear stress and atherosclerosis     129462037 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     129462037 (IL1B)    04936 Alcoholic liver disease     129462037 (IL1B)    04932 Non-alcoholic fatty liver disease     129462037 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     129462037 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     129462037 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129462037 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:ssyn00536]     129462037 (IL1B) Cytokines and neuropeptides [BR:ssyn04052]  Cytokines   Interleukins    129462037 (IL1B) Glycosaminoglycan binding proteins [BR:ssyn00536]  Heparan sulfate / Heparin   Cytokines    129462037 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  129462037 NCBI-ProteinID:  XP_055097618 LinkDB All DBs Position 14:40598799..40605867 Genome browser AA seq 269 aa AA seqDB search MAEVPELASEMMAYYSGNEDDLFFEVDGPKQMKCLFQDLDLCPLDGGIQLRISHQHYSKG FRQAVSVVVAMEKLRKMLVPCPQSFQDNDLSTLFPFIFEEEPIFFDTRDDEAYVHDAPVR SLNCTLRDAQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS NT seq 810 nt NT seq  +upstreamnt  +downstreamnt atggcagaagtacctgaactcgccagtgaaatgatggcttactacagtggcaatgaggat gacttgttctttgaagtcgatggccctaaacagatgaagtgcctcttccaggacctggac ctctgccctctggatggcggcatccagctacgaatctcccaccagcactacagcaagggc ttcaggcaggccgtgtcagttgttgtggccatggagaagctgaggaagatgctggttccc tgcccacagagcttccaggacaatgacctgagcaccttatttcccttcatctttgaagaa gaacctatcttctttgacacacgggatgacgaggcttatgtgcacgatgcacctgtacga tcactgaactgcacactccgggacgcacagcaaaaaagcttggtgatgtctggtccatat gaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatg tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaa aagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata gaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacc tctcaagcagaaaacatgcctgtcttcctgggagggacaaaaggcggccaggatataact gacttcaccatgcaatttgtgtcttcctaa

DBGET integrated database retrieval system