Symphalangus syndactylus (siamang): 129464727 Help Entry 129464727         CDS       T10134                                  Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04010   MAPK signaling pathway ssyn04014   Ras signaling pathway ssyn04024   cAMP signaling pathway ssyn04072   Phospholipase D signaling pathway ssyn04137   Mitophagy - animal ssyn04140   Autophagy - animal ssyn04218   Cellular senescence ssyn04371   Apelin signaling pathway ssyn04625   C-type lectin receptor signaling pathway ssyn04810   Regulation of actin cytoskeleton ssyn05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129464727    04014 Ras signaling pathway     129464727    04371 Apelin signaling pathway     129464727    04072 Phospholipase D signaling pathway     129464727    04024 cAMP signaling pathway     129464727  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129464727    04137 Mitophagy - animal     129464727   09143 Cell growth and death    04218 Cellular senescence     129464727   09142 Cell motility    04810 Regulation of actin cytoskeleton     129464727  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129464727  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     129464727  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssyn04147]     129464727    04031 GTP-binding proteins [BR:ssyn04031]     129464727 Exosome [BR:ssyn04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129464727   Exosomal proteins of bladder cancer cells    129464727 GTP-binding proteins [BR:ssyn04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129464727 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  129464727 NCBI-ProteinID:  XP_063475525 LinkDB All DBs Position 16:29294801..29298796 Genome browser AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVIF NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaggagaagtaccggcttgtggtggtc ggcgggggcggcgtgggcaagtcggcgctcactatccagttcatccagtcctattttgta acggattatgatccaaccattgaagattcttacacaaagcagtgtgtgatagatgacaga gcagcccggctagatattttggatacagcaggacaagaagagtttggagccatgagagaa cagtatatgaggactggcgagggcttcctgttggtcttttcagtcacagatagaggcagt tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttc ccaatgattttaattggtaataaagcagatctggatcatcaaagacaggtaacgcaggaa gaaggacagcagttagcacggcaacttaaggtaacatacatggaggcatcagcaaagatt aggatgaatgtagatcaagctttccatgaacttgtccgggttatcaggaaatttcaagag caggaatgtcctccttcaccagaaccaacacggaaagaaaaagataagaaaggctgccat tgtgtcatattctag

DBGET integrated database retrieval system