Symphalangus syndactylus (siamang): 129464830 Help Entry 129464830         CDS       T10134                                  Symbol CCL28 Name (RefSeq) C-C motif chemokine 28   KO K05513   C-C motif chemokine 28 Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04060   Cytokine-cytokine receptor interaction ssyn04061   Viral protein interaction with cytokine and cytokine receptor ssyn04062   Chemokine signaling pathway ssyn04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129464830 (CCL28)    04061 Viral protein interaction with cytokine and cytokine receptor     129464830 (CCL28)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     129464830 (CCL28)    04062 Chemokine signaling pathway     129464830 (CCL28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129464830 (CCL28) Cytokines and neuropeptides [BR:ssyn04052]  Cytokines   Chemokines    129464830 (CCL28) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Herpes_UL52 Motif Other DBs NCBI-GeneID:  129464830 NCBI-ProteinID:  XP_063475956 LinkDB All DBs Position 16:61196686..61229192 Genome browser AA seq 80 aa AA seqDB search MCRIQRADGDCDLAAVILHVKRRRICVSPHNHIVKQWMKVQAAKKNGKGNVCHRKKHHGK RNSNRAHQGKHETYGHKTPY NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtgtcgcatccagagagctgatggggattgtgacttggctgctgtcatccttcatgtc aagcgcagaagaatctgtgtcagcccgcacaaccatattgttaagcagtggatgaaagtg caagctgctaagaaaaatggtaaaggaaatgtttgccacaggaagaaacaccacggcaag aggaacagtaacagggcacatcaggggaaacacgaaacatacggccataaaactccttat tag

DBGET integrated database retrieval system