Symphalangus syndactylus (siamang): 129465924 Help Entry 129465924         CDS       T10134                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04015   Rap1 signaling pathway ssyn04810   Regulation of actin cytoskeleton ssyn05014   Amyotrophic lateral sclerosis ssyn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     129465924 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129465924 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129465924 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129465924 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssyn04131]     129465924 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ssyn04812]     129465924 (PFN2)    04147 Exosome [BR:ssyn04147]     129465924 (PFN2) Membrane trafficking [BR:ssyn04131]  Others   Actin-binding proteins    Others     129465924 (PFN2) Cytoskeleton proteins [BR:ssyn04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      129465924 (PFN2) Exosome [BR:ssyn04147]  Exosomal proteins   Proteins found in most exosomes    129465924 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  129465924 NCBI-ProteinID:  XP_055104617 LinkDB All DBs Position 17:complement(51768041..51774178) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gtggctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system