Symphalangus syndactylus (siamang): 129469463 Help Entry 129469463         CDS       T10134                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04081   Hormone signaling ssyn04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     129469463 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     129469463 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129469463 (GAST) Cytokines and neuropeptides [BR:ssyn04052]  Neuropeptides   GPCR binding    129469463 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  129469463 NCBI-ProteinID:  XP_055112068 LinkDB All DBs Position 20:42289486..42293420 Genome browser AA seq 104 aa AA seqDB search MQRLCVYALIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLDQQGPASHHRRQL GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDENQQP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgtgtatgcgctgatctttgcactggctctggccgccttctctgaa gcttcttggaagccccgctcccagcagccagatgcacccttaggtacaggggccaacagg gacctggagctaccctggctggaccagcagggcccagcctctcaccaccgaaggcagctg ggaccccagggtcccccacacctcgtggcagacccgtccaagaagcagggaccatggcta gaggaagaagaagaagcctatggatggatggacttcggtcgccgcagtgctgaggatgag aaccaacaaccctag

DBGET integrated database retrieval system