Symphalangus syndactylus (siamang): 129473164 Help Entry 129473164         CDS       T10134                                  Name (RefSeq) histone H2B type 1-A-like   KO K11252   histone H2B Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04613   Neutrophil extracellular trap formation ssyn05034   Alcoholism ssyn05203   Viral carcinogenesis ssyn05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ssyn00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129473164  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     129473164   09163 Immune disease    05322 Systemic lupus erythematosus     129473164   09165 Substance dependence    05034 Alcoholism     129473164  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ssyn03036]     129473164   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssyn04147]     129473164 Chromosome and associated proteins [BR:ssyn03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129473164 Exosome [BR:ssyn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129473164 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  129473164 NCBI-ProteinID:  XP_055119378 LinkDB All DBs Position 23:45119863..45120290 Genome browser AA seq 134 aa AA seqDB search MLELASKGTTISKKGTTISKKGFRKAIAKTQKKEDKKRKRCRKESYSIYIYKMLKQVHPD TGISSKAMSIMNSFVSNIFERIAGEASRLAHYDKRSTITSREIQTAVRLLLPGELAKHAV SEGTKAVTKYTSSK NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgctggagcttgcttcaaagggcactaccatttccaaaaagggcactaccatttccaaa aagggcttcaggaaggcaattgctaaaactcaaaagaaggaggacaaaaagcgcaagaga tgccgcaaagagagctattctatttacatttacaagatgttgaagcaggtacacccggac actggaatctcttccaaggccatgagtatcatgaattcttttgttagtaacatttttgag cgcattgcgggtgaggcttctcgcctggcgcattatgacaagcgttcgaccatcacctcc agagagatccagacggccgtgcgcttgctgctgcccggggaactagccaagcacgctgtg tcggagggcaccaaggctgtcaccaagtacaccagctccaagtag

DBGET integrated database retrieval system