Symphalangus syndactylus (siamang): 129478851
Help
Entry
129478851 CDS
T10134
Symbol
AK1
Name
(RefSeq) adenylate kinase isoenzyme 1 isoform X1
KO
K00939
adenylate kinase [EC:
2.7.4.3
]
Organism
ssyn Symphalangus syndactylus (siamang)
Pathway
ssyn00230
Purine metabolism
ssyn00730
Thiamine metabolism
ssyn01100
Metabolic pathways
ssyn01232
Nucleotide metabolism
ssyn01240
Biosynthesis of cofactors
Module
ssyn_M00049
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:
ssyn00001
]
09100 Metabolism
09104 Nucleotide metabolism
00230 Purine metabolism
129478851 (AK1)
09108 Metabolism of cofactors and vitamins
00730 Thiamine metabolism
129478851 (AK1)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
ssyn04147
]
129478851 (AK1)
Enzymes [BR:
ssyn01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.4 Phosphotransferases with a phosphate group as acceptor
2.7.4.3 adenylate kinase
129478851 (AK1)
Exosome [BR:
ssyn04147
]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
129478851 (AK1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ADK
AAA_17
AAA_18
AAA_33
Thymidylate_kin
Zeta_toxin
AAA_19
Cytidylate_kin
nSTAND3
AAA_22
ABC_tran
NTPase_1
dNK
NB-ARC
Motif
Other DBs
NCBI-GeneID:
129478851
NCBI-ProteinID:
XP_055126944
LinkDB
All DBs
Position
3:16936300..16954644
Genome browser
AA seq
194 aa
AA seq
DB search
MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKKLSEI
MEKGQLVPLETVLDMLRDAMVAKVDTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDA
GPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVD
SVFSQVCTHLDALK
NT seq
585 nt
NT seq
+upstream
nt +downstream
nt
atggaagagaagctgaagaaaaccaagatcatctttgtggtgggcgggcctggctcaggg
aagggcacccagtgtgagaagatcgtgcagaagtatggctacacccacctctccaccggg
gacctcctgcgggccgaggtcagctcaggctcggccaggggcaagaaactgtcggaaatc
atggagaaggggcagctggttccgctggagacagtgttggacatgctccgggatgccatg
gtggccaaagtcgatacttccaaaggcttcctgattgatggctacccgcgggaggtgcag
caaggagaagagtttgagcgacggattggacagcccacactgctgctgtatgtggacgca
ggccctgagaccatgacccagcggctcttgaaacgtggagagaccagcgggcgtgtggac
gacaatgaggagaccatcaaaaagcggctggagacctattacaaggccacagaacccgtc
atcgccttctatgagaaacgtggcattgtgcgcaaggtcaatgccgagggctccgtggac
agtgtcttctcccaggtctgcacccacctggacgccctaaagtag
DBGET
integrated database retrieval system