Symphalangus syndactylus (siamang): 129479089 Help Entry 129479089         CDS       T10134                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04010   MAPK signaling pathway ssyn04020   Calcium signaling pathway ssyn04022   cGMP-PKG signaling pathway ssyn04114   Oocyte meiosis ssyn04218   Cellular senescence ssyn04310   Wnt signaling pathway ssyn04360   Axon guidance ssyn04370   VEGF signaling pathway ssyn04380   Osteoclast differentiation ssyn04625   C-type lectin receptor signaling pathway ssyn04650   Natural killer cell mediated cytotoxicity ssyn04658   Th1 and Th2 cell differentiation ssyn04659   Th17 cell differentiation ssyn04660   T cell receptor signaling pathway ssyn04662   B cell receptor signaling pathway ssyn04720   Long-term potentiation ssyn04724   Glutamatergic synapse ssyn04921   Oxytocin signaling pathway ssyn04922   Glucagon signaling pathway ssyn04924   Renin secretion ssyn05010   Alzheimer disease ssyn05014   Amyotrophic lateral sclerosis ssyn05020   Prion disease ssyn05022   Pathways of neurodegeneration - multiple diseases ssyn05031   Amphetamine addiction ssyn05152   Tuberculosis ssyn05163   Human cytomegalovirus infection ssyn05166   Human T-cell leukemia virus 1 infection ssyn05167   Kaposi sarcoma-associated herpesvirus infection ssyn05170   Human immunodeficiency virus 1 infection ssyn05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ssyn05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129479089 (PPP3R2)    04310 Wnt signaling pathway     129479089 (PPP3R2)    04370 VEGF signaling pathway     129479089 (PPP3R2)    04020 Calcium signaling pathway     129479089 (PPP3R2)    04022 cGMP-PKG signaling pathway     129479089 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129479089 (PPP3R2)    04218 Cellular senescence     129479089 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129479089 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     129479089 (PPP3R2)    04660 T cell receptor signaling pathway     129479089 (PPP3R2)    04658 Th1 and Th2 cell differentiation     129479089 (PPP3R2)    04659 Th17 cell differentiation     129479089 (PPP3R2)    04662 B cell receptor signaling pathway     129479089 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     129479089 (PPP3R2)    04921 Oxytocin signaling pathway     129479089 (PPP3R2)    04924 Renin secretion     129479089 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     129479089 (PPP3R2)    04720 Long-term potentiation     129479089 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     129479089 (PPP3R2)    04380 Osteoclast differentiation     129479089 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129479089 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129479089 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     129479089 (PPP3R2)    05163 Human cytomegalovirus infection     129479089 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     129479089 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     129479089 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     129479089 (PPP3R2)    05014 Amyotrophic lateral sclerosis     129479089 (PPP3R2)    05020 Prion disease     129479089 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     129479089 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     129479089 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129479089 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ssyn01009]     129479089 (PPP3R2) Protein phosphatases and associated proteins [BR:ssyn01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129479089 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  129479089 NCBI-ProteinID:  XP_055127615 LinkDB All DBs Position 3:43251173..43252110 Genome browser AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR VIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGFISNGELFQVLK MMVGNNLMDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg gggacctcccagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgttcagc atttacgacatggataaagatggctttatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctgatggactggcagctccagcagctggtcgacaaaaccatc atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system