Symphalangus syndactylus (siamang): 129480656 Help Entry 129480656         CDS       T10134                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04060   Cytokine-cytokine receptor interaction ssyn04061   Viral protein interaction with cytokine and cytokine receptor ssyn04151   PI3K-Akt signaling pathway ssyn04625   C-type lectin receptor signaling pathway ssyn04630   JAK-STAT signaling pathway ssyn04658   Th1 and Th2 cell differentiation ssyn04659   Th17 cell differentiation ssyn04660   T cell receptor signaling pathway ssyn04672   Intestinal immune network for IgA production ssyn04940   Type I diabetes mellitus ssyn05135   Yersinia infection ssyn05142   Chagas disease ssyn05162   Measles ssyn05166   Human T-cell leukemia virus 1 infection ssyn05171   Coronavirus disease - COVID-19 ssyn05200   Pathways in cancer ssyn05320   Autoimmune thyroid disease ssyn05321   Inflammatory bowel disease ssyn05330   Allograft rejection ssyn05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129480656 (IL2)    04151 PI3K-Akt signaling pathway     129480656 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129480656 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     129480656 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129480656 (IL2)    04660 T cell receptor signaling pathway     129480656 (IL2)    04658 Th1 and Th2 cell differentiation     129480656 (IL2)    04659 Th17 cell differentiation     129480656 (IL2)    04672 Intestinal immune network for IgA production     129480656 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129480656 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129480656 (IL2)    05171 Coronavirus disease - COVID-19     129480656 (IL2)    05162 Measles     129480656 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     129480656 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     129480656 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     129480656 (IL2)    05321 Inflammatory bowel disease     129480656 (IL2)    05330 Allograft rejection     129480656 (IL2)    05332 Graft-versus-host disease     129480656 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     129480656 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129480656 (IL2)    00536 Glycosaminoglycan binding proteins [BR:ssyn00536]     129480656 (IL2) Cytokines and neuropeptides [BR:ssyn04052]  Cytokines   Interleukins    129480656 (IL2) Glycosaminoglycan binding proteins [BR:ssyn00536]  Heparan sulfate / Heparin   Cytokines    129480656 (IL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL2 Plasmid_RAQPRD Motif Other DBs NCBI-GeneID:  129480656 NCBI-ProteinID:  XP_055130636 LinkDB All DBs Position 4:52277629..52282898 Genome browser AA seq 153 aa AA seqDB search MYRMQLLSCIALSLALVTNGAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVQELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaatggt gcacctacttcaagttctacaaagaaaacacaactacaactggagcatttactgctggat ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta agacccagggacttaatcagcaatatcaacgtaatagttcaggaactaaagggatctgaa acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system