Symphalangus syndactylus (siamang): 129483187 Help Entry 129483187         CDS       T10134                                  Name (RefSeq) histone H3.Y   KO K11253   histone H3 Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04613   Neutrophil extracellular trap formation ssyn05034   Alcoholism ssyn05202   Transcriptional misregulation in cancer ssyn05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ssyn00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129483187  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129483187   09163 Immune disease    05322 Systemic lupus erythematosus     129483187   09165 Substance dependence    05034 Alcoholism     129483187  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ssyn03036]     129483187   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssyn04147]     129483187 Chromosome and associated proteins [BR:ssyn03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129483187 Exosome [BR:ssyn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129483187 SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF Motif Other DBs NCBI-GeneID:  129483187 NCBI-ProteinID:  XP_055136185 LinkDB All DBs Position 5:75109690..75110670 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKATAWQAPRKPLATKAVGKRAPPKGGIKKPHRYKPGTLALREIRKYQKSTQ LLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTI MPRDMQLARRLRREGP NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcaccaagcagaccgcccgcaaagccaccgcctggcaggcccccaggaaaccc ctggccaccaaagccgtcggaaaaagggcgccgcctaaaggagggatcaagaagcctcac cgctacaagcctggcactctggcgctgcgggaaatcagaaagtaccagaagtccacgcag ctgctcctgcgcaagctgcccttccagcgcctggtgcgcgagatcgcccaggccatcagc ccggacctgcgcttccagagcgcggccattggcgccctgcaggaggccagcgaggcctac ctggtgcaactctttgaagacaccaacctgtgtgccatccatgccaggcgcgtcacaatt atgccaagagacatgcagctggcccgccgcctccgcagagagggtccttaa

DBGET integrated database retrieval system