Symphalangus syndactylus (siamang): 129484268 Help Entry 129484268         CDS       T10134                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04610   Complement and coagulation cascades ssyn04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:ssyn00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     129484268 (CD59)    04610 Complement and coagulation cascades     129484268 (CD59)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssyn04147]     129484268 (CD59)    04090 CD molecules [BR:ssyn04090]     129484268 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssyn00537]     129484268 (CD59) Exosome [BR:ssyn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129484268 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    129484268 (CD59)   Exosomal proteins of colorectal cancer cells    129484268 (CD59) CD molecules [BR:ssyn04090]  Proteins   129484268 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssyn00537]  Antigens   129484268 (CD59) SSDB OrthologParalogGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Activin_recp Motif Other DBs NCBI-GeneID:  129484268 NCBI-ProteinID:  XP_055137963 LinkDB All DBs Position 6:22555101..22577398 Genome browser AA seq 128 aa AA seqDB search MGIQGGSVLCGLLLVLAVFCHSGHSLQCYDCPNPTADCKTAVNCSSGFDVCLITKAGLRV YNRCWKSENCDFNNISTHLKENELTYNCCKKDLCNFNERFGNGGTSLSEKTVLLLVTPFL AATWSLHP NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgggaatccaaggagggtctgtcctgtgcgggctgctgctcgttctggctgtcttctgc cattcaggtcatagcctgcagtgctacgactgtcctaacccaactgctgactgcaaaaca gccgtcaattgttcatctggttttgatgtgtgtctcattaccaaagctggtttacgagtg tataaccggtgttggaagtctgagaattgcgatttcaacaacatttcaacccacttgaag gaaaatgagctaacgtacaactgctgcaagaaggacctgtgtaactttaacgaacggttt ggaaatggtgggacatccttatcagagaaaacagttcttctgctggtgactccatttctg gcagcaacctggagccttcatccctaa

DBGET integrated database retrieval system