Symphalangus syndactylus (siamang): 129487637 Help Entry 129487637         CDS       T10134                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn00190   Oxidative phosphorylation ssyn01100   Metabolic pathways ssyn01524   Platinum drug resistance ssyn04115   p53 signaling pathway ssyn04210   Apoptosis ssyn04215   Apoptosis - multiple species ssyn04932   Non-alcoholic fatty liver disease ssyn05010   Alzheimer disease ssyn05012   Parkinson disease ssyn05014   Amyotrophic lateral sclerosis ssyn05016   Huntington disease ssyn05017   Spinocerebellar ataxia ssyn05020   Prion disease ssyn05022   Pathways of neurodegeneration - multiple diseases ssyn05132   Salmonella infection ssyn05134   Legionellosis ssyn05145   Toxoplasmosis ssyn05152   Tuberculosis ssyn05160   Hepatitis C ssyn05161   Hepatitis B ssyn05162   Measles ssyn05163   Human cytomegalovirus infection ssyn05164   Influenza A ssyn05167   Kaposi sarcoma-associated herpesvirus infection ssyn05168   Herpes simplex virus 1 infection ssyn05169   Epstein-Barr virus infection ssyn05170   Human immunodeficiency virus 1 infection ssyn05200   Pathways in cancer ssyn05210   Colorectal cancer ssyn05222   Small cell lung cancer ssyn05416   Viral myocarditis ssyn05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssyn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     129487637  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     129487637    04215 Apoptosis - multiple species     129487637    04115 p53 signaling pathway     129487637  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129487637   09162 Cancer: specific types    05210 Colorectal cancer     129487637    05222 Small cell lung cancer     129487637   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129487637    05161 Hepatitis B     129487637    05160 Hepatitis C     129487637    05164 Influenza A     129487637    05162 Measles     129487637    05168 Herpes simplex virus 1 infection     129487637    05163 Human cytomegalovirus infection     129487637    05167 Kaposi sarcoma-associated herpesvirus infection     129487637    05169 Epstein-Barr virus infection     129487637   09171 Infectious disease: bacterial    05132 Salmonella infection     129487637    05134 Legionellosis     129487637    05152 Tuberculosis     129487637   09174 Infectious disease: parasitic    05145 Toxoplasmosis     129487637   09164 Neurodegenerative disease    05010 Alzheimer disease     129487637    05012 Parkinson disease     129487637    05014 Amyotrophic lateral sclerosis     129487637    05016 Huntington disease     129487637    05017 Spinocerebellar ataxia     129487637    05020 Prion disease     129487637    05022 Pathways of neurodegeneration - multiple diseases     129487637   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129487637    05416 Viral myocarditis     129487637   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     129487637   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     129487637 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  129487637 NCBI-ProteinID:  XP_055144709 LinkDB All DBs Position 8:41040174..41040556 Genome browser AA seq 103 aa AA seqDB search MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGITW GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKSY NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctctttgggcggaag acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcacctgg ggagaggataccctgatggagtacttggagaatcccaagaagtacatccctggaacaaaa atgatctttgtcggcattaagaagaaggaagaaagggcagacttaatagcttatctcaaa aaaagctactaa

DBGET integrated database retrieval system