Symphalangus syndactylus (siamang): 129489215 Help Entry 129489215         CDS       T10134                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04024   cAMP signaling pathway ssyn04062   Chemokine signaling pathway ssyn04064   NF-kappa B signaling pathway ssyn04210   Apoptosis ssyn04380   Osteoclast differentiation ssyn04620   Toll-like receptor signaling pathway ssyn04621   NOD-like receptor signaling pathway ssyn04622   RIG-I-like receptor signaling pathway ssyn04623   Cytosolic DNA-sensing pathway ssyn04625   C-type lectin receptor signaling pathway ssyn04657   IL-17 signaling pathway ssyn04658   Th1 and Th2 cell differentiation ssyn04659   Th17 cell differentiation ssyn04660   T cell receptor signaling pathway ssyn04662   B cell receptor signaling pathway ssyn04668   TNF signaling pathway ssyn04722   Neurotrophin signaling pathway ssyn04920   Adipocytokine signaling pathway ssyn04926   Relaxin signaling pathway ssyn04931   Insulin resistance ssyn04936   Alcoholic liver disease ssyn05132   Salmonella infection ssyn05134   Legionellosis ssyn05135   Yersinia infection ssyn05140   Leishmaniasis ssyn05142   Chagas disease ssyn05145   Toxoplasmosis ssyn05160   Hepatitis C ssyn05161   Hepatitis B ssyn05162   Measles ssyn05163   Human cytomegalovirus infection ssyn05164   Influenza A ssyn05166   Human T-cell leukemia virus 1 infection ssyn05167   Kaposi sarcoma-associated herpesvirus infection ssyn05168   Herpes simplex virus 1 infection ssyn05169   Epstein-Barr virus infection ssyn05170   Human immunodeficiency virus 1 infection ssyn05171   Coronavirus disease - COVID-19 ssyn05200   Pathways in cancer ssyn05203   Viral carcinogenesis ssyn05208   Chemical carcinogenesis - reactive oxygen species ssyn05215   Prostate cancer ssyn05220   Chronic myeloid leukemia ssyn05222   Small cell lung cancer ssyn05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ssyn05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     129489215 (NFKBIA)    04668 TNF signaling pathway     129489215 (NFKBIA)    04024 cAMP signaling pathway     129489215 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     129489215 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129489215 (NFKBIA)    04621 NOD-like receptor signaling pathway     129489215 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     129489215 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     129489215 (NFKBIA)    04625 C-type lectin receptor signaling pathway     129489215 (NFKBIA)    04660 T cell receptor signaling pathway     129489215 (NFKBIA)    04658 Th1 and Th2 cell differentiation     129489215 (NFKBIA)    04659 Th17 cell differentiation     129489215 (NFKBIA)    04657 IL-17 signaling pathway     129489215 (NFKBIA)    04662 B cell receptor signaling pathway     129489215 (NFKBIA)    04062 Chemokine signaling pathway     129489215 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     129489215 (NFKBIA)    04926 Relaxin signaling pathway     129489215 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     129489215 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     129489215 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129489215 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     129489215 (NFKBIA)    05203 Viral carcinogenesis     129489215 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129489215 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     129489215 (NFKBIA)    05215 Prostate cancer     129489215 (NFKBIA)    05222 Small cell lung cancer     129489215 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129489215 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     129489215 (NFKBIA)    05161 Hepatitis B     129489215 (NFKBIA)    05160 Hepatitis C     129489215 (NFKBIA)    05171 Coronavirus disease - COVID-19     129489215 (NFKBIA)    05164 Influenza A     129489215 (NFKBIA)    05162 Measles     129489215 (NFKBIA)    05168 Herpes simplex virus 1 infection     129489215 (NFKBIA)    05163 Human cytomegalovirus infection     129489215 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     129489215 (NFKBIA)    05169 Epstein-Barr virus infection     129489215 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     129489215 (NFKBIA)    05135 Yersinia infection     129489215 (NFKBIA)    05134 Legionellosis     129489215 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     129489215 (NFKBIA)    05140 Leishmaniasis     129489215 (NFKBIA)    05142 Chagas disease     129489215 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129489215 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129489215 (NFKBIA)    04931 Insulin resistance     129489215 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ssyn03000]     129489215 (NFKBIA)    04131 Membrane trafficking [BR:ssyn04131]     129489215 (NFKBIA) Transcription factors [BR:ssyn03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     129489215 (NFKBIA) Membrane trafficking [BR:ssyn04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     129489215 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  129489215 NCBI-ProteinID:  XP_055147506 LinkDB All DBs Position 9:18900000..18906238 Genome browser AA seq 317 aa AA seqDB search MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL NT seq 954 nt NT seq  +upstreamnt  +downstreamnt atgttccaggcggccgagcgcccccaggagtgggccatggagggcccccgcgacgggctg aagaaggagcggctactggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgttcctgcacttg gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg ggagtcctgactcagtcctgcaccaccccgcacctccactccatcctgaaggctaccaac tacaatggccacacgtgtctacacttagcctctatccatggctacctgggcatcgtggag cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccggactgcc cttcacctcgcagtggacctgcagaatcctgacctggtatcgctcctgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgt ccaagcacccggatacagcagcagctgggccagctgacgctagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacggag gacgagctgccctatgatgactgtgtgtttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system