Symphalangus syndactylus (siamang): 129490334 Help Entry 129490334         CDS       T10134                                  Name (RefSeq) interferon alpha-5   KO K05414   interferon alpha Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04060   Cytokine-cytokine receptor interaction ssyn04151   PI3K-Akt signaling pathway ssyn04217   Necroptosis ssyn04620   Toll-like receptor signaling pathway ssyn04621   NOD-like receptor signaling pathway ssyn04622   RIG-I-like receptor signaling pathway ssyn04623   Cytosolic DNA-sensing pathway ssyn04630   JAK-STAT signaling pathway ssyn04650   Natural killer cell mediated cytotoxicity ssyn04936   Alcoholic liver disease ssyn05152   Tuberculosis ssyn05160   Hepatitis C ssyn05161   Hepatitis B ssyn05162   Measles ssyn05163   Human cytomegalovirus infection ssyn05164   Influenza A ssyn05165   Human papillomavirus infection ssyn05167   Kaposi sarcoma-associated herpesvirus infection ssyn05168   Herpes simplex virus 1 infection ssyn05169   Epstein-Barr virus infection ssyn05170   Human immunodeficiency virus 1 infection ssyn05171   Coronavirus disease - COVID-19 ssyn05200   Pathways in cancer ssyn05320   Autoimmune thyroid disease ssyn05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129490334    04151 PI3K-Akt signaling pathway     129490334   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129490334  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129490334  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129490334    04621 NOD-like receptor signaling pathway     129490334    04622 RIG-I-like receptor signaling pathway     129490334    04623 Cytosolic DNA-sensing pathway     129490334    04650 Natural killer cell mediated cytotoxicity     129490334  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129490334   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129490334    05161 Hepatitis B     129490334    05160 Hepatitis C     129490334    05171 Coronavirus disease - COVID-19     129490334    05164 Influenza A     129490334    05162 Measles     129490334    05168 Herpes simplex virus 1 infection     129490334    05163 Human cytomegalovirus infection     129490334    05167 Kaposi sarcoma-associated herpesvirus infection     129490334    05169 Epstein-Barr virus infection     129490334    05165 Human papillomavirus infection     129490334   09171 Infectious disease: bacterial    05152 Tuberculosis     129490334   09163 Immune disease    05320 Autoimmune thyroid disease     129490334   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129490334   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129490334  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129490334 Cytokines and neuropeptides [BR:ssyn04052]  Cytokines   Interferons    129490334 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND Motif Other DBs NCBI-GeneID:  129490334 NCBI-ProteinID:  XP_055150070 LinkDB All DBs Position 9:118398534..118399681 Genome browser AA seq 189 aa AA seqDB search MSLPFALLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG FPQEEFDGNQFQKAPAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLE ACMMQEVGVEDTPLMNVDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTN LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgtccttgccctttgctttactaatggccctggtggtgctcaactgcaagtcaatctgt tctctgggctgtgatctgcctcagactcacagcctgagtaacaggaggactttgatgatc atggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctacttgg gatgagacacttctagacaaattctacactgaactttaccagcagctgaatgacctggaa gcctgtatgatgcaggaggttggagtggaagacactcctctgatgaatgtggactctatc ctggcggtgagaaaatactttcaaagaatcactctctatctgacagagaagaaatacagc ccttgtgcatgggaggttgttagagcagaaatcatgagatccttctctttatcaacaaac ttgcaagaaagattaaggaggaaggagtga

DBGET integrated database retrieval system