KEGG   Symphalangus syndactylus (siamang): 129492567
Entry
129492567         CDS       T10134                                 
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
ssyn  Symphalangus syndactylus (siamang)
Pathway
ssyn03050  Proteasome
ssyn05010  Alzheimer disease
ssyn05012  Parkinson disease
ssyn05014  Amyotrophic lateral sclerosis
ssyn05016  Huntington disease
ssyn05017  Spinocerebellar ataxia
ssyn05020  Prion disease
ssyn05022  Pathways of neurodegeneration - multiple diseases
ssyn05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ssyn00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    129492567 (PSMD7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    129492567 (PSMD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129492567 (PSMD7)
   05012 Parkinson disease
    129492567 (PSMD7)
   05014 Amyotrophic lateral sclerosis
    129492567 (PSMD7)
   05016 Huntington disease
    129492567 (PSMD7)
   05017 Spinocerebellar ataxia
    129492567 (PSMD7)
   05020 Prion disease
    129492567 (PSMD7)
   05022 Pathways of neurodegeneration - multiple diseases
    129492567 (PSMD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ssyn03051]
    129492567 (PSMD7)
Proteasome [BR:ssyn03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     129492567 (PSMD7)
SSDB
Motif
Pfam: MitMem_reg JAB Connexin Coilin_N
Other DBs
NCBI-GeneID: 129492567
NCBI-ProteinID: XP_055153768
LinkDB
Position
11:23675942..23685503
AA seq 324 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KEDKEKDKDKEKSDVKKEEKKEKK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaatcggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
gggtcatggcaaaagaaagtacttgatgtatcgaacagttttgcagttccttttgatgaa
gatgacaaagacgattctgtgtggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaagtcaatgccagagaaagaatagttggctggtaccacacaggccctaaa
ctacacaagaatgacattgccatcaacgaactcatgaaaagatactgtcctaattctgta
ttggtcatcattgatgtgaagccaaaggacctagggctgcccacagaagcgtacatttca
gtggaagaagtccatgatgatggaactccaacctcgaaaacatttgaacacgtgaccagt
gaaattggagcagaggaagctgaggaagttggagttgaacacttgttacgagatatcaaa
gacacgacggtgggcactctgtcccagcggatcacaaaccaggtccatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacctcgaaaaagtcgccacaggcaagctg
cccatcaaccaccagatcatctaccagctgcaggacgtcttcaacctgctgccagacgtc
agcctgcaggaatttgtcaaggccttttacctgaagaccaacgaccagatggtggttgta
tacttggcctcgctgatccgttccgtggttgccctgcacaacctcatcaacaacaagatt
gccaatcgggatgcagagaagaaagaagggcaggagaaagaagagagcaaaaaggatagg
aaagaggacaaggagaaagataaagataaggaaaagagtgatgtaaagaaagaggagaaa
aaggagaaaaagtaa

DBGET integrated database retrieval system