Symphalangus syndactylus (siamang): 134734188 Help Entry 134734188         CDS       T10134                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn01521   EGFR tyrosine kinase inhibitor resistance ssyn01522   Endocrine resistance ssyn04010   MAPK signaling pathway ssyn04012   ErbB signaling pathway ssyn04014   Ras signaling pathway ssyn04015   Rap1 signaling pathway ssyn04062   Chemokine signaling pathway ssyn04068   FoxO signaling pathway ssyn04071   Sphingolipid signaling pathway ssyn04072   Phospholipase D signaling pathway ssyn04137   Mitophagy - animal ssyn04140   Autophagy - animal ssyn04150   mTOR signaling pathway ssyn04151   PI3K-Akt signaling pathway ssyn04210   Apoptosis ssyn04211   Longevity regulating pathway ssyn04213   Longevity regulating pathway - multiple species ssyn04218   Cellular senescence ssyn04360   Axon guidance ssyn04370   VEGF signaling pathway ssyn04371   Apelin signaling pathway ssyn04540   Gap junction ssyn04550   Signaling pathways regulating pluripotency of stem cells ssyn04625   C-type lectin receptor signaling pathway ssyn04650   Natural killer cell mediated cytotoxicity ssyn04660   T cell receptor signaling pathway ssyn04662   B cell receptor signaling pathway ssyn04664   Fc epsilon RI signaling pathway ssyn04714   Thermogenesis ssyn04720   Long-term potentiation ssyn04722   Neurotrophin signaling pathway ssyn04725   Cholinergic synapse ssyn04726   Serotonergic synapse ssyn04730   Long-term depression ssyn04810   Regulation of actin cytoskeleton ssyn04910   Insulin signaling pathway ssyn04912   GnRH signaling pathway ssyn04915   Estrogen signaling pathway ssyn04916   Melanogenesis ssyn04917   Prolactin signaling pathway ssyn04919   Thyroid hormone signaling pathway ssyn04921   Oxytocin signaling pathway ssyn04926   Relaxin signaling pathway ssyn04929   GnRH secretion ssyn04933   AGE-RAGE signaling pathway in diabetic complications ssyn04935   Growth hormone synthesis, secretion and action ssyn05010   Alzheimer disease ssyn05022   Pathways of neurodegeneration - multiple diseases ssyn05034   Alcoholism ssyn05160   Hepatitis C ssyn05161   Hepatitis B ssyn05163   Human cytomegalovirus infection ssyn05165   Human papillomavirus infection ssyn05166   Human T-cell leukemia virus 1 infection ssyn05167   Kaposi sarcoma-associated herpesvirus infection ssyn05170   Human immunodeficiency virus 1 infection ssyn05200   Pathways in cancer ssyn05203   Viral carcinogenesis ssyn05205   Proteoglycans in cancer ssyn05206   MicroRNAs in cancer ssyn05207   Chemical carcinogenesis - receptor activation ssyn05208   Chemical carcinogenesis - reactive oxygen species ssyn05210   Colorectal cancer ssyn05211   Renal cell carcinoma ssyn05213   Endometrial cancer ssyn05214   Glioma ssyn05215   Prostate cancer ssyn05216   Thyroid cancer ssyn05218   Melanoma ssyn05219   Bladder cancer ssyn05220   Chronic myeloid leukemia ssyn05221   Acute myeloid leukemia ssyn05223   Non-small cell lung cancer ssyn05224   Breast cancer ssyn05225   Hepatocellular carcinoma ssyn05226   Gastric cancer ssyn05230   Central carbon metabolism in cancer ssyn05231   Choline metabolism in cancer ssyn05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ssyn05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134734188 (NRAS)    04012 ErbB signaling pathway     134734188 (NRAS)    04014 Ras signaling pathway     134734188 (NRAS)    04015 Rap1 signaling pathway     134734188 (NRAS)    04370 VEGF signaling pathway     134734188 (NRAS)    04371 Apelin signaling pathway     134734188 (NRAS)    04068 FoxO signaling pathway     134734188 (NRAS)    04072 Phospholipase D signaling pathway     134734188 (NRAS)    04071 Sphingolipid signaling pathway     134734188 (NRAS)    04151 PI3K-Akt signaling pathway     134734188 (NRAS)    04150 mTOR signaling pathway     134734188 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134734188 (NRAS)    04137 Mitophagy - animal     134734188 (NRAS)   09143 Cell growth and death    04210 Apoptosis     134734188 (NRAS)    04218 Cellular senescence     134734188 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     134734188 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     134734188 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134734188 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     134734188 (NRAS)    04650 Natural killer cell mediated cytotoxicity     134734188 (NRAS)    04660 T cell receptor signaling pathway     134734188 (NRAS)    04662 B cell receptor signaling pathway     134734188 (NRAS)    04664 Fc epsilon RI signaling pathway     134734188 (NRAS)    04062 Chemokine signaling pathway     134734188 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     134734188 (NRAS)    04929 GnRH secretion     134734188 (NRAS)    04912 GnRH signaling pathway     134734188 (NRAS)    04915 Estrogen signaling pathway     134734188 (NRAS)    04917 Prolactin signaling pathway     134734188 (NRAS)    04921 Oxytocin signaling pathway     134734188 (NRAS)    04926 Relaxin signaling pathway     134734188 (NRAS)    04935 Growth hormone synthesis, secretion and action     134734188 (NRAS)    04919 Thyroid hormone signaling pathway     134734188 (NRAS)    04916 Melanogenesis     134734188 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     134734188 (NRAS)    04726 Serotonergic synapse     134734188 (NRAS)    04720 Long-term potentiation     134734188 (NRAS)    04730 Long-term depression     134734188 (NRAS)    04722 Neurotrophin signaling pathway     134734188 (NRAS)   09158 Development and regeneration    04360 Axon guidance     134734188 (NRAS)   09149 Aging    04211 Longevity regulating pathway     134734188 (NRAS)    04213 Longevity regulating pathway - multiple species     134734188 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     134734188 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     134734188 (NRAS)    05206 MicroRNAs in cancer     134734188 (NRAS)    05205 Proteoglycans in cancer     134734188 (NRAS)    05207 Chemical carcinogenesis - receptor activation     134734188 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     134734188 (NRAS)    05203 Viral carcinogenesis     134734188 (NRAS)    05230 Central carbon metabolism in cancer     134734188 (NRAS)    05231 Choline metabolism in cancer     134734188 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     134734188 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     134734188 (NRAS)    05225 Hepatocellular carcinoma     134734188 (NRAS)    05226 Gastric cancer     134734188 (NRAS)    05214 Glioma     134734188 (NRAS)    05216 Thyroid cancer     134734188 (NRAS)    05221 Acute myeloid leukemia     134734188 (NRAS)    05220 Chronic myeloid leukemia     134734188 (NRAS)    05218 Melanoma     134734188 (NRAS)    05211 Renal cell carcinoma     134734188 (NRAS)    05219 Bladder cancer     134734188 (NRAS)    05215 Prostate cancer     134734188 (NRAS)    05213 Endometrial cancer     134734188 (NRAS)    05224 Breast cancer     134734188 (NRAS)    05223 Non-small cell lung cancer     134734188 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     134734188 (NRAS)    05170 Human immunodeficiency virus 1 infection     134734188 (NRAS)    05161 Hepatitis B     134734188 (NRAS)    05160 Hepatitis C     134734188 (NRAS)    05163 Human cytomegalovirus infection     134734188 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     134734188 (NRAS)    05165 Human papillomavirus infection     134734188 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     134734188 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     134734188 (NRAS)   09165 Substance dependence    05034 Alcoholism     134734188 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     134734188 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     134734188 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     134734188 (NRAS)    01522 Endocrine resistance     134734188 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssyn04131]     134734188 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssyn04147]     134734188 (NRAS)    04031 GTP-binding proteins [BR:ssyn04031]     134734188 (NRAS) Membrane trafficking [BR:ssyn04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     134734188 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     134734188 (NRAS) Exosome [BR:ssyn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134734188 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    134734188 (NRAS)   Exosomal proteins of breast cancer cells    134734188 (NRAS)   Exosomal proteins of colorectal cancer cells    134734188 (NRAS) GTP-binding proteins [BR:ssyn04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     134734188 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  134734188 NCBI-ProteinID:  XP_063481916 LinkDB All DBs Position 19:complement(67359838..67368354) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system