Symphalangus syndactylus (siamang): 134735725 Help Entry 134735725         CDS       T10134                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04613   Neutrophil extracellular trap formation ssyn05034   Alcoholism ssyn05202   Transcriptional misregulation in cancer ssyn05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ssyn00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     134735725  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     134735725   09163 Immune disease    05322 Systemic lupus erythematosus     134735725   09165 Substance dependence    05034 Alcoholism     134735725  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ssyn03036]     134735725   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssyn04147]     134735725 Chromosome and associated proteins [BR:ssyn03036]  Eukaryotic type   Nucleosome assembly factors    Histones     134735725 Exosome [BR:ssyn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134735725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  134735725 NCBI-ProteinID:  XP_063488859 LinkDB All DBs Position 23:44586513..44605162 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgcaccaagcagactgcacggaagtccaccggtggcaaagcgccgcgcaagcag cttgccactaaggcggctcggaaaagcgcgccggctaccggcggcgtaaagaaacctcat cgctaccgtcccggcaccgttgctctgcgcgagattcgccgctaccagaagtcgactgag ctgctgatccgaaagttgcctttccaacgcctggtgcgagaaatagctcaggacttcaag acagatctgcgctttcagagttccgcggtgatggccctgcaggaggcctgcgaggcctac ttggtggggctttttgaggacaccaacctgtgtgccatccatgctaagcgagtgactatc atgcccaaggacattcagctcgctcgccgcattcgtggggagagagcgtag

DBGET integrated database retrieval system