Streptomyces tanashiensis: LDH80_09685 Help Entry LDH80_09685       CDS       T08718                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism staa  Streptomyces tanashiensis Pathway staa00253   Tetracycline biosynthesis staa01056   Biosynthesis of type II polyketide backbone staa01100   Metabolic pathways staa01110   Biosynthesis of secondary metabolites Module staa_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:staa00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     LDH80_09685    00253 Tetracycline biosynthesis     LDH80_09685  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:staa01004]     LDH80_09685    01008 Polyketide biosynthesis proteins [BR:staa01008]     LDH80_09685 Lipid biosynthesis proteins [BR:staa01004]  Polyketide synthase   Component type    LDH80_09685 Polyketide biosynthesis proteins [BR:staa01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      LDH80_09685     Nonaketide PKS      LDH80_09685     Decaketide PKS      LDH80_09685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UZX20966 LinkDB All DBs Position complement(2148827..2149102) Genome browser AA seq 91 aa AA seqDB search MSSGIKTFELGDLKRILKEGVGADESVDLEGDILDVDFEALGYESLAMLETGTRIEREFG VVLTDETLTETATPRRLIEAVNVQLRSVPTV NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtcttccggaatcaagaccttcgaactcggtgatctgaagcgaattctcaaggaaggg gtcggcgccgacgaaagtgtcgacctggaaggtgacatactcgacgtggatttcgaggcg ctcggatatgaatccctggcgatgctggagacgggaacccggattgagcgcgagttcggt gtcgtcctcacggacgagacgctcaccgagaccgccacgccgcgccggctgatcgaggcc gtgaacgtccagctgcgttccgtcccgaccgtctga

DBGET integrated database retrieval system