Streptomyces tanashiensis: LDH80_27170 Help Entry LDH80_27170       CDS       T08718                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism staa  Streptomyces tanashiensis Pathway staa00998   Biosynthesis of various antibiotics staa01100   Metabolic pathways staa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:staa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LDH80_27170    00074 Mycolic acid biosynthesis     LDH80_27170   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LDH80_27170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UZX24159 UniProt:  A0ABY6R5F3 LinkDB All DBs Position complement(5990365..5990613) Genome browser AA seq 82 aa AA seqDB search MADTQEEILKGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctgacacccaggaagagatcctcaagggcctcgccgagatcgtcaacgagatcgcc ggcatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagaccgtgggcgacgccgccgactacatcctgaagcac caggactga

DBGET integrated database retrieval system