Spiroplasma tabanidicola: STABA_v1c09650 Help Entry STABA_v1c09650    CDS       T06336                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stab  Spiroplasma tabanidicola Pathway stab01100   Metabolic pathways stab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STABA_v1c09650 (acpP)    00074 Mycolic acid biosynthesis     STABA_v1c09650 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STABA_v1c09650 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QGS52318 UniProt:  A0A6I6CDC6 LinkDB All DBs Position complement(1126033..1126272) Genome browser AA seq 79 aa AA seqDB search MVIRMNYFEEIKRTLINKGAKAAITKDTELKSLGLDSLDLMDMVVFLEEKLDITLSDDQL MGMNTVNDLVKIIESLAKN NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggtgattagaatgaattattttgaagaaataaaaagaactcttataaataaaggagct aaagcagcaattactaaagatacagaattaaaatctttagggttggactcactagatctt atggacatggtagtttttttagaagaaaaacttgatataactttatcagatgatcaatta atgggcatgaatactgtaaatgatctagtaaaaataatcgaatctttagctaaaaactaa

DBGET integrated database retrieval system