Stanieria sp. NIES-3757: STA3757_13150 Help Entry STA3757_13150     CDS       T05130                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism stan  Stanieria sp. NIES-3757 Pathway stan00190   Oxidative phosphorylation stan00195   Photosynthesis stan01100   Metabolic pathways Module stan_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:stan00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     STA3757_13150    00195 Photosynthesis     STA3757_13150  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:stan00194]     STA3757_13150 Photosynthesis proteins [BR:stan00194]  Photosystem and electron transport system   F-type ATPase [OT]    STA3757_13150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  BAU63946 UniProt:  A0A140K3L9 LinkDB All DBs Position 1446740..1446979 Genome browser AA seq 79 aa AA seqDB search MDINAASVIAAALAIGLAAIGPGIGQGNASGQAVAGIARQPEAEGKIRGTLLLTLAFMES LTIYGLVVALVLLFANPFV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggatattaacgctgcttctgttatcgctgctgctttagcaattggtttagctgctatc ggtcctggtatcggtcaaggaaacgcttctggtcaagcagtagctgggattgctcgtcag cccgaagctgaaggaaaaattcgtggtactctacttttaactttagcgttcatggaatct cttaccatttacggcctagtagttgctttagtactactatttgctaaccccttcgtataa

DBGET integrated database retrieval system