Staphylococcus sp. AntiMn-1: AOB58_715 Help Entry AOB58_715         CDS       T09786                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stap  Staphylococcus sp. AntiMn-1 Pathway stap00998   Biosynthesis of various antibiotics stap01100   Metabolic pathways stap01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stap00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AOB58_715    00074 Mycolic acid biosynthesis     AOB58_715   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AOB58_715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ANK37517 LinkDB All DBs Position complement(753801..754034) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDAEKVTKEASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNFINSIEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgacaaagtaaaagatatcatcgttgaccgtttaggtgttgacgctgaa aaagtaactaaagaggcatctttcaaagatgatttaggcgctgactcacttgatattgct gaattagttatggaattagaagacgaatttggtactgaaattcctgatgaagaagctgaa aaaatcaacactgttggtgacgcagtaaactttattaatagtatcgaaaaataa

DBGET integrated database retrieval system