Starkeya sp. ORNL1: G3545_23640 Help Entry G3545_23640       CDS       T06785                                  Name (GenBank) cytochrome C oxidase subunit IV   KO K02277   cytochrome c oxidase subunit IV [EC:7.1.1.9] Organism star  Starkeya sp. ORNL1 Pathway star00190   Oxidative phosphorylation star01100   Metabolic pathways Module star_M00155   Cytochrome c oxidase, prokaryotes Brite KEGG Orthology (KO) [BR:star00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     G3545_23640 Enzymes [BR:star01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.9  cytochrome-c oxidase      G3545_23640 SSDB OrthologParalogGFIT Motif Pfam:  COX4_pro LNT_N DUF4407 DUF5693 YdeH_helical Motif Other DBs NCBI-ProteinID:  QJP17834 LinkDB All DBs Position 5009775..5010059 Genome browser AA seq 94 aa AA seqDB search MRLYLVVWGWLFVLSTCSYLVDYFHLQGHLRYSLILLFMVLKAGLIVAVFMHMAWERLAL VYAILLPVGAVLVFVAIMVLESDYTLMTRIHPGL NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atccggctctatcttgtggtgtggggctggctgttcgtgctcagcacctgctcctacctg gtcgactatttccacctgcaggggcatctgcgctattcgctgatactgctgttcatggtg ttgaaggccggcctgatcgtcgccgtcttcatgcacatggcgtgggagcgattggcgctg gtctacgccatcctgctccccgtcggcgccgtgctggtgttcgtcgccatcatggtgctg gagtcggactacacgctgatgacccgcatccacccgggcctttga

DBGET integrated database retrieval system