KEGG   Spongiibacter taiwanensis: NCG89_05365
Entry
NCG89_05365       CDS       T08367                                 
Name
(GenBank) ABC transporter transmembrane domain-containing protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
staw  Spongiibacter taiwanensis
Brite
KEGG Orthology (KO) [BR:staw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:staw02000]
    NCG89_05365
Transporters [BR:staw02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    NCG89_05365
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 RsgA_GTPase AAA_22 Zeta_toxin AAA_21 ABC_ATPase AAA_16
Other DBs
NCBI-ProteinID: USA44210
LinkDB
Position
complement(1145179..1146978)
AA seq 599 aa
MTEQGSEREKSSNIRVLGAMLRFLRPYRWQAGLASVALVCTAGITLSIGQGLRLLIDNGF
AEGASPAELNRALLFFMAMVLLLAAGTFTRFYFVSWIGERVSADLRKSVFDHILTLHPGF
FETNVSGEIQSRITTDTSLIQTVIGSSVSIALRNLLMFVGGLVLLFVTNPKLTAMVMLSV
PLVVAPILIFGRRVRKLSRDSQDRIASVGSFVGEAIKNIKLVQAFNHQAADSARLGEHVE
AAFAVARGRIQQRAWLSTAVIVLVLGAVSAMLWVGGHDVLAGRISGGELAAFIFYAVMVA
ASVGAISEVFGDLQRAAGASERLLELLAAQSLVAPPADPMTLPEPAGGRLSLDNISFHYP
SRPDTWAIDQLSLTLAPGASLALVGSSGAGKSTLIDLILRFYDVQKGAICFEGVDIRQLD
PQVLRQHIAMVPQQPVLFTGTVADNIRYGKPGASDEALVNAARAAYAHDFIAALPEGYHS
FVGEGGIRLSGGQRQRIAIARAILADPKLLLLDEATSALDAESEYQVQKALETLMQGRTS
IVIAHRLATVVNVDTIAVLDGGRLVATGSHSELLQRSELYARWASLQFDDAHSAASVAG
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgactgaacagggtagcgaacgggaaaaaagcagcaatatccgggtgctgggcgccatg
ctgcgatttttgcgtccctaccgctggcaggctggcctggccagtgtcgccctggtgtgc
accgcagggatcaccctgtcgatcgggcaaggtctgcgcctgctgattgataacggcttt
gccgagggggcatctcccgccgaattaaatcgcgccctgttgttttttatggccatggtg
ctgctgttggcggcggggactttcacccgattttactttgtctcctggattggcgagcgg
gtcagcgccgatctgcgcaaaagcgtcttcgaccatattctcacccttcaccccggcttt
tttgaaaccaatgtcagcggtgaaattcaatcccgaatcaccaccgataccagcctgatt
cagaccgtgatcggcagttcggtgtcgattgccctgcgcaatctgttgatgtttgtcggc
ggcctggtgctgctgtttgtgaccaaccccaagctcacggccatggtgatgctcagtgtg
cccttggtggtcgcgccgattctgatttttggccgccgggtgcgcaaactgtcacgggac
agtcaggaccgtatcgccagtgtgggcagctttgtgggcgaggcaattaaaaatatcaag
ctggtgcaggcctttaatcaccaggccgccgacagcgctcgactgggcgagcacgtcgag
gcggccttcgccgtggcacggggacggatacaacaacgcgcctggttgtctaccgccgtc
attgtactggtgcttggcgcggtcagcgccatgctgtgggtgggcggtcacgatgtgctg
gccgggcgaatcagcggtggtgagctggccgcatttatcttttacgccgtcatggtggcg
gcttcggtgggggccatctcagaggtgtttggtgatttgcagcgcgcggcgggtgccagt
gagcggctgttggaactgctggccgctcaaagcctagtggccccgccagccgatccaatg
accctgccagagccggccggtgggcgcctgagcctggacaatatcagtttccactaccct
tcgcgcccagatacctgggcgattgatcagctcagcctgaccctggctccgggcgcaagc
ctcgccctggtggggagctccggcgccggcaagtcgacgctgattgatttgattctgcgg
ttctacgacgtgcaaaaaggggcgatctgcttcgagggtgtcgacattcgtcagcttgac
ccccaggtgttgcgtcagcatatcgccatggtgccccagcagccggtattgtttaccggc
acggtggcggacaatattcgctacggcaaacccggtgccagcgatgaagccctggttaac
gccgcgcgggcagcctacgcccacgactttatcgcggccctgcccgagggttaccacagt
tttgtaggcgagggtgggattcggctctcgggcgggcagcgccagcgcatcgccattgcc
cgggcgattctggcggacccaaaattgctgttgctggatgaagccaccagcgctctggac
gcggagagcgagtatcaggtgcaaaaggccctggagacgctgatgcaggggcgcacgtca
atcgtgattgcccatcgactggccacggtggtgaatgtcgataccatcgccgtgctcgac
ggcggtcgcctggttgccaccggcagtcacagcgaactgctgcagcgcagtgaattgtac
gcccgttgggccagtctacagtttgacgatgcccacagtgcggccagcgtcgccgggtag

DBGET integrated database retrieval system