Sphingomonas taxi: MC45_03820 Help Entry MC45_03820        CDS       T03398                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism stax  Sphingomonas taxi Pathway stax01100   Metabolic pathways stax01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:stax00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MC45_03820    00074 Mycolic acid biosynthesis     MC45_03820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MC45_03820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIT05674 UniProt:  A0A097EDN3 LinkDB All DBs Position 867569..867841 Genome browser AA seq 90 aa AA seqDB search MLPEGYDTVETTVRAVLRDVLGLSADRVAGFTATTPLFGALPELDSMAVAGVLTEIEDRL GILIEDDEVDGDMLETFGALVEFAANKALV NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgcttcccgaaggctatgataccgtcgaaaccaccgtccgcgccgtgctgcgcgatgtg ctcggcctctccgcggaccgcgtcgcgggcttcaccgcgacgacgccgctgttcggcgcg ttgcccgaactcgattcaatggccgtcgccggcgtcctgaccgagatcgaggaccggctc ggcatcctgatcgaggacgacgaggtcgacggcgacatgctcgagacgttcggcgcgctc gtcgagtttgcggcgaacaaggcgctcgtctag

DBGET integrated database retrieval system