KEGG   Sphingomonas taxi: MC45_07615
Entry
MC45_07615        CDS       T03398                                 
Name
(GenBank) permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
stax  Sphingomonas taxi
Pathway
stax02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stax00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MC45_07615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stax02000]
    MC45_07615
Transporters [BR:stax02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    MC45_07615
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: AIT06272
UniProt: A0A097EFC4
LinkDB
Position
1701708..1702883
AA seq 391 aa
MARLIALPLFSTLTIAAMLLVLDRIQRLFVFVATEGGPVSVVWRMLANLLPEYLGLGIPI
GLLLGILLAFRRLAANSELDVLRAVGVSYTRMLRVPFMYALILAALNIAIVGFVQPKARY
YYEQLRFELRTGALGASIKVGEFTHFGDRMTLRIEQSHDKGRKLDGIFVYYNDKGTSYSV
TAQSGQFLATDDPNTIIFRLTKGTLVHKAPNFTVPRVLTFTSHDLPIPLPRYENFRQRGG
RNLEFTLPELAKLGHRAQSEEQRDSSRSEFHFRLVEVATMFLLPLLAIALGVPPKRSNSG
FGVFLAIVMIVAYHKVNEYAASIGELGRIDPLIALWVPFCIFAGIILWMYYQIAYVPGGQ
PIGALERAFSKLAKLVTRYLPGRGRKKEQAA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggcccggctgatcgcgttgccgctattctcgacgctgaccatcgccgccatgctgctg
gtgctcgaccgtatccagcgcctgttcgtcttcgtcgccaccgagggtgggccggtcagc
gtcgtgtggcggatgctcgccaatctgctgcccgaatatctcggccttggcataccgatc
gggctgctgctcggcatcctgctcgccttccgccgcctcgccgccaattcggaactcgac
gtgctgcgcgccgtgggggtgagctacacgcggatgctgcgcgtgccgttcatgtacgcg
ctgatcctcgcggcgctcaacatcgcgatcgtcggcttcgtccagccaaaggcgcgctat
tattacgagcagttgcgcttcgagctgcgcaccggcgcgctgggcgcgtcgatcaaggtc
ggcgagttcacccatttcggcgaccgcatgacgctgcgcatcgagcagagccatgacaag
ggccgcaagctcgacggcatcttcgtctattacaacgacaagggtaccagctattcggtc
accgcccagtcgggccagttcctcgccaccgacgatcccaacacgatcatcttccgcctg
acgaagggcactttggtgcacaaggcgcccaatttcaccgtgccgcgggtgctgaccttc
acctcgcacgatctgccgatcccgctgccgcgctacgagaatttccgccagcgcggcggc
cgcaacctcgaattcacgttgcccgaactcgcaaagctcggccatcgcgcgcagagcgag
gagcagcgcgacagcagccgctccgaattccacttccgcctggtcgaggtggcgacgatg
ttcctgttgccgctgctcgcgatcgcgctcggcgtgccgcccaaacgctccaattcgggc
ttcggcgtgttcctcgcgatcgtgatgatcgtcgcctatcacaaggtgaacgaatatgcc
gcctcgatcggcgagctcggccggatcgatccgctgatcgcgctctgggtccccttctgc
atcttcgccgggatcatcctctggatgtattatcagatcgcctatgtccccggcgggcaa
ccgatcggcgcgctcgaacgcgccttctcgaagctcgccaagctcgtcacccgctatctg
cccggccgcggccgcaagaaggagcaggcggcatga

DBGET integrated database retrieval system