Sphingomonas taxi: MC45_08715 Help Entry MC45_08715        CDS       T03398                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism stax  Sphingomonas taxi Brite KEGG Orthology (KO) [BR:stax00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:stax03110]     MC45_08715 Chaperones and folding catalysts [BR:stax03110]  Protein folding catalysts   Protein disulfide isomerase    MC45_08715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_3 SH3BGR GST_N Motif Other DBs NCBI-ProteinID:  AIT06437 UniProt:  A0A097EFU5 LinkDB All DBs Position complement(1934211..1934468) Genome browser AA seq 85 aa AA seqDB search MAKVEIYTKAYCPYCTRAMALLAAKGVSPQEYDISLGGPQRQEMIQRANGRTTVPQVFID GTHIGGSDDLAALNARGGLDPLLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcaaaggtcgaaatctacaccaaggcatattgtccctattgcacgcgcgcgatggcg ttgctggcagccaagggcgtgtcgccgcaggaatatgacatctcgcttggcgggccgcag cggcaggagatgatccagcgcgccaacggccgcaccaccgtgccgcaggtattcatcgac ggcacgcatatcggtggctcggacgatctcgccgcgctcaacgcgcgcggaggattggac ccgctgctcgcggcatga

DBGET integrated database retrieval system