Sphingomonas taxi: MC45_12545 Help Entry MC45_12545        CDS       T03398                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism stax  Sphingomonas taxi Pathway stax02020   Two-component system stax02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:stax00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     MC45_12545  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     MC45_12545  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:stax02035]     MC45_12545 Bacterial motility proteins [BR:stax02035]  Flagellar system   Flagellar assembly proteins    Others     MC45_12545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AIT08211 UniProt:  A0A097EKW4 LinkDB All DBs Position 2745409..2745717 Genome browser AA seq 102 aa AA seqDB search MVDSIGSTPLNGSGSVSRVAAPAAAPAVQPALQQAAQQAPAANTATQLTNLARTLAAEPP IDSDRVDEIKKAIQNGSFPILPATIADRLLALRLNWDGHDAA NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggtggactcgatcggctcaacgccgctgaacggaagtggaagcgtttcgcgcgtcgcc gccccagcggctgcgccggcggtgcagcccgcattgcaacaggcggcgcaacaggccccc gcggcgaacaccgcgacgcaattgaccaatctcgccaggacgctggcggccgaaccgccg atcgacagcgaccgcgtcgacgagatcaagaaggcgatccagaacggctcgttcccgatc ctgccggcgacgatcgccgaccggctcctcgcactccggctgaactgggatggccatgac gcggcgtga

DBGET integrated database retrieval system