KEGG   Sphingomonas taxi: MC45_15450
Entry
MC45_15450        CDS       T03398                                 
Name
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
stax  Sphingomonas taxi
Pathway
stax00260  Glycine, serine and threonine metabolism
stax00261  Monobactam biosynthesis
stax00270  Cysteine and methionine metabolism
stax00300  Lysine biosynthesis
stax01100  Metabolic pathways
stax01110  Biosynthesis of secondary metabolites
stax01120  Microbial metabolism in diverse environments
stax01210  2-Oxocarboxylic acid metabolism
stax01230  Biosynthesis of amino acids
Module
stax_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
stax_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stax00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MC45_15450
   00270 Cysteine and methionine metabolism
    MC45_15450
   00300 Lysine biosynthesis
    MC45_15450
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    MC45_15450
Enzymes [BR:stax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     MC45_15450
SSDB
Motif
Pfam: AA_kinase ACT_9 ACT_7 ACT ACT_AHAS_ss ACT_6 Transglut_core
Other DBs
NCBI-ProteinID: AIT07536
UniProt: A0A097EIY5
LinkDB
Position
3379968..3381230
AA seq 420 aa
MARIVMKFGGTSMAGIERIRSVAARVKREVEAGNQVAVVVSAMAGETDRLVGFCREASSL
YDPREYDVVVAAGEQITSGLLAIALQAAGVPARSWLGWQLPIHTDDAHAKARIGSIEVDA
LNASMAAGEVAVIPGFQGLSDDGRVTTLGRGGSDTSAVAVAAAMKADRCDIYTDVDGVYT
TDPRIVPRARKLNKVTYEEMLELASVGAKVLQTRSVGLAMKEQVRVQVLSSFTGPEAPMA
DTLPGTMIVGEEEIDDVERQLITGIAHDKNEAKITLTSVPDQPGAVSAIFEPLAAANINV
DMIIQNIAHNHGSTDVTFTVPSADLARSLEALNQARETIGFAELVHDTRVAKVSVVGVGM
RSHAGVASTMFTTLGKRGINIQAISTSEIKVSVLIHEDETELAVRMLHTAYGLDAADAAA
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcacgcatcgtgatgaagttcggcggcacgtcgatggccgggatcgagcgcatcagg
agcgtcgccgcgcgcgtcaaacgcgaggtcgaggcgggcaatcaggtcgcggtggtcgtc
tcggcgatggcgggcgagaccgaccggctggtcggcttctgccgcgaggcctcgtcgctc
tacgatccgcgcgaatatgacgtcgtcgtcgccgcgggcgaacagatcaccagcgggctg
ctcgcgatcgccttgcaggcggcgggcgtgccggcgcgctcgtggctcggctggcaattg
ccgatccataccgacgacgcgcacgccaaggcgcggatcggcagcatcgaggtcgacgcg
ctcaacgccagcatggcggcgggcgaggtcgcggtgatccccggtttccagggcctgtcg
gacgacggccgcgtcaccacgctcggccgcggcggttcggacacgtcggcggtggcggtg
gcggcggcgatgaaggccgaccgttgcgacatctacaccgacgtcgacggcgtctacacc
accgacccgcgcatcgtgccgcgcgcgcgcaagctcaacaaggtgacgtacgaagagatg
ctggaactcgccagcgtcggcgcgaaggtgttgcagacccgttcggtcggcctcgcgatg
aaggaacaggtccgcgtccaggtgctctcgtccttcaccggacccgaggcgccgatggcg
gacacattgcccggtacgatgatcgtgggcgaagaggagatcgacgacgtggaacgccag
ctcatcacgggtatcgcgcacgacaagaacgaggcgaagatcacgctgaccagcgtcccc
gaccagccgggcgcggtgtcggcgatcttcgagccgctcgccgcggcgaacatcaacgtc
gacatgatcatccagaatatcgcgcacaaccacggctcgaccgacgtcaccttcaccgtg
ccgtccgccgatctggcgcgcagccttgaggcgctcaaccaggcgcgcgagacgatcggc
ttcgccgaactggtccacgacacgcgcgtcgccaaggtctcggtggtcggcgtcggcatg
cgcagccatgccggcgtcgccagcacgatgttcaccacgctcggcaagcgcggcatcaac
atccaggcgatctcgaccagcgagatcaaggtcagcgtgctgatccacgaggacgagacc
gaactcgccgtccgcatgctgcacaccgcctacggcctcgacgccgcggacgccgccgcg
tga

DBGET integrated database retrieval system